(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0091

BA000012.MLR0091     Location/Qualifiers
FT   CDS_pept        63082..63420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0091"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47748"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47748"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL3"
FT                   /protein_id="BAB47748.1"
FT                   /translation="MNDSLYLDEARDPLIIAEGWMKDGKDVAIATVVETWGSAPRPVGS
FT                   HLVIDADGNFHGSVSGGCVEGAVVSEAVDVIGSGKARMLEFGVADETAWQVGLSCGGRI
FT                   KVYVERLG"
     atgaacgaca gtctttatct cgatgaggcc cgcgatccgc tgatcatcgc ggaaggttgg        60
     atgaaggatg gcaaggatgt cgccattgcc accgtggtcg agacctgggg ttcggcgccg       120
     aggcctgtcg gcagccatct ggtcatcgat gcggacggca attttcacgg ttcggtctcg       180
     ggcggctgcg tcgagggcgc ggtggtgagc gaggcggtcg acgtcatcgg ctcgggcaag       240
     gccaggatgc tcgaattcgg cgtcgccgac gaaaccgcct ggcaggtcgg cctgtcctgc       300
     ggcggccgca tcaaggtgta tgtcgagcgg ttgggctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page