(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0093

BA000012.MLR0093     Location/Qualifiers
FT   CDS_pept        64231..65841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0093"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47750"
FT                   /db_xref="InterPro:IPR012184"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL1"
FT                   /protein_id="BAB47750.1"
FT                   /translation="MKFGPIAIEEAEGAVLAHSTTAGEKRFRKAHRLSAEDISVLKRAG
FT                   IVQVVAAVLSPDDLGEDAAAQRIAESMRFSGIEARPAATGRVNLHAKASGIFTVDAAMI
FT                   DAINAVDPAITLATLAQHAPVEKGQMVATVKIIPFAVASTLVDTVVKICAGGEILAVNA
FT                   YQPVRVGVIQTVLPGIKPSVLDKTLRVTEARLARSGGRLTAERRTPHEIAPVAEAAASL
FT                   ARDNDLVVIFGASAMSDFADVVPAAIERAGGTVVRAGMPVDPGNLLVLGTLGGKRIIGA
FT                   PGCARSPKENGFDWVLDRLVAGLDVTAKDIAGMGVGGLLMEIPTRPQPREPLPAKSRLK
FT                   VGIVLLAAGRSSRMGGPNKLLALFDGKPLVRRTAERALGSKASGTIVVTGHQRERVRAA
FT                   LSGLDVTFADNPDFANGLSTSLKAGIAYLPEDTAGAMIVLGDMPGVVSGDLDRLIDAFR
FT                   KAGGNSVVRASHQGKRGNPVLLPRALFPAIAHLEGDTGARHLVEAEGLDVVDVEIGEGA
FT                   SVDVDTREALEGAGGVLQD"
     gtgaaattcg gtccgattgc gattgaagag gccgaaggcg cggtgctggc gcattccacc        60
     accgctggtg aaaagcgctt tcgcaaggcg cacaggctga gcgctgaaga catctccgta       120
     ctcaagcggg caggcatcgt gcaggtcgtt gcggccgtgc tttcccccga tgatctgggc       180
     gaggacgccg cggcgcaaag aattgccgag agcatgaggt tcagcggcat cgaggcgagg       240
     ccggccgcca ccggccgagt caatctccac gccaaggcat caggcatctt cacggtcgat       300
     gctgcgatga tcgacgccat caacgccgtc gatcccgcca tcacccttgc cacgctggcg       360
     cagcatgcgc cggtcgaaaa gggtcagatg gtggcgacgg tgaagatcat ccccttcgcg       420
     gtcgcctcca ccttggtcga cactgttgtg aaaatctgcg ccggcggcga gatccttgcc       480
     gtcaacgcct atcagccggt gcgcgtcggc gtcatccaga cggtcctgcc gggcatcaaa       540
     cccagcgtgc tcgacaagac gctgcgcgtc accgaagcgc ggctggcgcg ttcgggcggc       600
     aggttgacgg cggagcgccg aacgccgcat gagatcgcac ccgtggcgga ggccgccgcc       660
     tcgctggcgc gcgacaatga cctggtggtg atcttcggcg cctcggcgat gagcgatttc       720
     gccgatgtcg ttccagcggc gatcgagagg gcgggcggaa cagttgtccg cgccggcatg       780
     ccggtcgatc ccggcaatct gctggtgctc ggtacactcg gcggcaagcg catcatcggc       840
     gcgccgggct gcgcccgcag tcccaaggag aacggcttcg actgggtcct tgaccgtctt       900
     gttgccggcc tcgacgtcac cgcgaaggat atcgccggca tgggggtcgg cgggctgctg       960
     atggaaatcc cgacgcgacc gcagccgcgc gaaccgctgc cggccaagag ccggctcaag      1020
     gtcggcatcg tgcttttggc agccggccgg tcgagccgca tgggcgggcc gaacaaactg      1080
     ctggcgctgt tcgacggcaa gccgctggtg cgccgcaccg ccgagcgcgc gctcggctcg      1140
     aaggcgtcag gcacgatcgt cgtcaccggc catcagcgcg agcgcgtacg cgcggctttg      1200
     tctggcctcg acgtcacttt cgccgacaat cccgattttg ccaatgggtt gtcgacctcg      1260
     ctgaaggccg gcattgccta tctgcccgaa gacaccgccg gcgcgatgat cgttctggga      1320
     gatatgcctg gtgttgtgtc aggcgatctc gaccggctga tcgatgcctt ccgcaaggcc      1380
     ggtggcaatt ccgtcgtccg cgcctcgcat cagggcaagc gcggcaaccc ggtgctcctg      1440
     ccgcgcgcgc tgttcccggc catcgctcat ctcgaaggcg ataccggcgc acgccatctg      1500
     gtcgaggccg aggggctcga cgtcgtcgat gtcgagattg gcgagggcgc ctctgtcgat      1560
     gtcgacaccc gtgaggcgct cgaaggcgcc ggcggcgtgc tgcaggattg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page