(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0109

BA000012.MLR0109     Location/Qualifiers
FT   CDS_pept        78156..78503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0109"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47764"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47764"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ7"
FT                   /protein_id="BAB47764.1"
FT                   /translation="METIGPAIAWPPLAAQGKATISGEAVCSAWGASMLRVQKVKVDEI
FT                   YVPTARKKTLHPETVRHLAEDILENGMKTPIQVRHDGKRHILVEGLHRLEAARWLGETE
FT                   IDAYLVQAKRH"
     atggaaacga tcgggccagc aattgcttgg ccgcccttgg ccgcacaagg caaagcgact        60
     atttcaggcg aggcggtatg ttccgcctgg ggagccagca tgctgagagt gcaaaaggtc       120
     aaggtcgacg agatctacgt gccgacggcg cgcaagaaga cattgcaccc agagaccgtc       180
     cgccatctgg ccgaggacat attggagaac ggcatgaaga cgccgatcca ggtccgccac       240
     gacggcaaac gccatatcct tgtcgaaggt ctgcaccggc tggaagcggc caggtggctc       300
     ggcgagaccg agatcgacgc ctatctggtg caagccaagc gccactga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page