(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0112

BA000012.MLR0112     Location/Qualifiers
FT   CDS_pept        80276..80674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0112"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47767"
FT                   /db_xref="GOA:Q98NJ4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ4"
FT                   /protein_id="BAB47767.1"
FT                   /translation="MAKHQGGCLCGAVRYSTDAAPINERICHCRLCQKAIGAAFNARVL
FT                   FRIDDVTIEGPLATVNTSPDLKRGFCPDCGTTMFSRRDSAGIIGITTGSLDDPTFFRPQ
FT                   MHIFTASKQPWVVLDDGLPQYEGAPPPG"
     atggcaaaac atcagggcgg gtgcctgtgc ggagcggtgc gctacagcac cgacgcggcg        60
     cccatcaacg aacgcatctg ccattgccgg ctttgccaga aggcaatcgg cgccgccttc       120
     aacgcccgcg tgctgtttcg catcgatgat gtgaccatcg aggggccgct ggcgaccgtg       180
     aacacctcgc ccgatctcaa gcgcggtttt tgcccggact gcggcacgac gatgttttcg       240
     cgtcgcgatt ccgccggcat catcggcatc accaccggct cgctcgacga tcccactttc       300
     ttcaggccgc agatgcatat tttcaccgcc tcgaaacagc cctgggtggt gctcgatgac       360
     ggcctgccgc aatatgaagg cgctccgccg ccaggctag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page