(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0116

BA000012.MLR0116     Location/Qualifiers
FT   CDS_pept        82193..82987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0116"
FT                   /product="integral membrane lipid kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47770"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47770"
FT                   /db_xref="GOA:Q98NJ1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NJ1"
FT                   /protein_id="BAB47770.1"
FT                   /translation="MQGITELLPISSTAHMRIVPALLGWQDPGSAFSAAMQLAALAAVI
FT                   SYFWGDVRDLLFGSLDALTRRDFSDRHFRLASWIVLATIPIVIAGVALSGVLNACNSPL
FT                   RSLTVIGWSCIAMAILLALAEIFARHKRTIAEASLADALLVGVAQIGALIPGVSRSGST
FT                   LTAALGLGFKRAEAARFSFLLGLPAIALAGLKELWELHKVHLDAHGWSVLATGLVVASI
FT                   SAFFAIWGLMRVLERFSAWPFVIYRGLLGVVLLLGLAMGWLA"
     gtgcaaggca tcaccgaatt gctgccgatt tcctcgactg cccatatgcg catcgtgccg        60
     gcgctactcg gctggcagga cccgggctcc gccttctccg ccgccatgca gcttgccgcc       120
     cttgccgccg tgatcagcta tttctggggc gatgtcaggg atctcctgtt cggctcgctc       180
     gatgcgctca cgaggcgcga tttttccgac cggcatttcc ggctagcgtc ctggatcgtg       240
     ctggcgacga tcccgatcgt cattgcaggc gtcgcgctat cgggcgttct caatgcctgc       300
     aattcgccgc tgcgcagcct gaccgtgatc ggctggtcct gtatcgccat ggcgatcctg       360
     ctggcgctgg ccgagatttt cgcccgccac aagcgcacca tcgcagaagc gtcgctcgcc       420
     gacgcgctgc ttgtcggcgt agcacagatc ggcgcgctga tccccggcgt ctcgcgctcg       480
     ggctcgaccc tgacggcggc gcttgggctc ggcttcaagc gggccgaggc ggcgcgcttc       540
     tcgttcctgc tcgggctgcc ggcgatcgcg cttgccggtc tcaaggaact gtgggagctg       600
     cacaaggttc atctcgacgc ccatggctgg tcggttcttg ccaccgggct ggtcgtcgcc       660
     tcgatctccg ccttctttgc catctggggc ctgatgcgag tgctggaacg cttctccgcc       720
     tggcctttcg tcatctatcg cggcctgctc ggcgtggtct tgttgctcgg cctggcgatg       780
     ggatggctgg cttga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page