(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0127

BA000012.MLR0127     Location/Qualifiers
FT   CDS_pept        87751..88011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0127"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47777"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47777"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI4"
FT                   /protein_id="BAB47777.1"
FT                   /translation="MLGWVGSDIGELVDDVGVVVGFVTHGRFPVVIFQTFPFDPIRRQI
FT                   VPISLRRVNGRPTAHPTGPTALSWMTATRFVEGGKSQNRGK"
     gtgctgggtt gggtcggctc tgacataggc gagctggttg acgatgtcgg tgtcgtcgtc        60
     gggttcgtca ctcatggccg ttttccggtt gttatcttcc agacgttccc attcgatccg       120
     atccgtcgtc aaattgtacc tatatcactt cgtcgtgtga atggtcgccc gaccgcccat       180
     ccaaccggtc cgaccgcctt atcttggatg acggcgacgc gattcgtcga aggtggcaaa       240
     agccagaacc gcggaaaatg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page