(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0133

BA000012.MLR0133     Location/Qualifiers
FT   CDS_pept        90601..91572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0133"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47782"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47782"
FT                   /db_xref="GOA:Q98NH9"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH9"
FT                   /protein_id="BAB47782.1"
FT                   /translation="MELELKFLLVGFACAVSGMLSLITFVKWREVQALSRWLPTPGKII
FT                   SSRVEAREVRSSGAGSDSTDTTEMRNFPAITFEYKVGGKKFQSSRYSVKENLGNFEVRE
FT                   TLAQFPRGAEVTVFYNPADPSKAVIERTMPDGAFKFMFQLSAGLVIGTAVLVFSVGGVL
FT                   EAIRPHLPKPQNLGAAALLLFMGLFALRMGFAQKSLAEQAAKWPVAAGRIDASGLQALR
FT                   THSSYQRWRTVFKSRIVYSYGVAGQCYSADRVTFGATVTASLPGLVSAQARNYAEGGKV
FT                   DVHYDPANPGSAVLECRVRGLWLLWVCSAGFLGGAAWLVGLV"
     gtggagctgg aactcaaatt tctgcttgtc ggctttgcct gcgcggtctc cggcatgctg        60
     tcgctcatca ccttcgtgaa atggcgggag gtgcaggcgc tcagccgctg gttgccgacg       120
     ccgggaaaga tcatctcgtc gcgcgtcgag gcgcgtgagg tcagaagctc gggcgctggc       180
     tcggacagca ccgataccac ggaaatgcga aatttcccgg caatcacctt cgaatacaaa       240
     gtcggcggca agaaatttca aagctcgcgc tacagcgtga aggaaaattt ggggaacttt       300
     gaagtccgcg aaacccttgc gcagtttccc cgcggcgcgg aggtgaccgt cttctacaat       360
     ccggctgatc cgagcaaagc cgtcatcgag cgcaccatgc cggacggcgc cttcaagttc       420
     atgttccagc tctcggccgg gttggtgatc ggcacggcgg ttctggtgtt ttccgttggc       480
     ggcgtgctcg aggcgatccg gccgcatctg cccaagccgc agaatctcgg cgccgccgca       540
     ctgctgctgt tcatgggcct gttcgccctg cgcatgggct tcgcccagaa gtcgctcgcc       600
     gagcaggcgg caaaatggcc ggtcgccgcc ggccgcatcg atgcgtcagg cctgcaggcg       660
     ctgcggaccc attcaagcta tcaacgctgg cgcaccgttt tcaaatcccg catcgtctac       720
     agctatggcg tcgccggcca gtgctacagc gccgaccgcg tcaccttcgg cgccacggtc       780
     acggcctcgc tgcccggcct cgtcagcgct caggcacgaa actatgccga gggcggcaag       840
     gtcgacgtgc actacgaccc tgccaatcct ggctcggcgg tgctcgaatg ccgggtgcgt       900
     ggactctggc tgctatgggt ctgttcggca ggatttctcg gcggcgctgc ctggctcgtc       960
     gggctggtgt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page