(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0150

BA000012.MLR0150     Location/Qualifiers
FT   CDS_pept        105672..106250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0150"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47797"
FT                   /db_xref="GOA:Q98NG4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG4"
FT                   /protein_id="BAB47797.1"
FT                   /translation="MEDRIRIRSEEVLSDDWAVLKKTVLDYRRRDGQWETQIRQTYDRG
FT                   DGAVILPYDPQRSTVLLVRQFRYPAYVTGHREPLIEACAGLLDENDPETAIRKEAEEEL
FT                   GYRLKDIERLFSPYMSPGSVTERLWFFIARYSPADRISAGGGAPEEGEDIEVLEMPLDE
FT                   ALAGIADGRIVDAKTIILIQHLKLNPMKA"
     atggaagatc gtattcgtat ccgttcggaa gaggttcttt ccgacgactg ggcggtgctg        60
     aaaaagaccg tgctcgacta tcgccggcgc gacgggcaat gggagacgca aatccgccag       120
     acctacgatc gcggcgatgg cgcggtgatt ttgccttacg acccccagcg ttcgacggtg       180
     ctcctggtgc gccagttccg ctatcccgcc tacgtcactg gccaccgcga accgctgatc       240
     gaggcctgtg ccgggctgct cgacgaaaac gatccggaaa ccgccatccg caaggaagcc       300
     gaggaagagc tcggctaccg gctgaaggat attgagcggc tgttttcgcc ttatatgagc       360
     ccgggcagcg tcaccgagcg gctgtggttc ttcattgccc gctattcgcc cgccgaccgc       420
     atctcggccg gcggcggcgc tccggaagag ggcgaggata tcgaggttct ggaaatgccg       480
     ctcgacgagg cgctggccgg catcgccgac ggtcgcatcg tcgatgccaa gacgattatc       540
     ctgatccagc atctgaagct gaacccgatg aaggcctag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page