(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0152

BA000012.MLR0152     Location/Qualifiers
FT   CDS_pept        108052..108435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0152"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47799"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47799"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG2"
FT                   /protein_id="BAB47799.1"
FT                   /translation="MEIPSTFRHAPWSAGTLDQCGAKRMSVGTALEQLLRLIHRRAMKL
FT                   AMLPEDERDSHYDRIRLSCCAAAEHIGQDPDQAAITANDMVEFVRALVGIIEMGSGPDH
FT                   ERNADQRSPMLPSGGQEHVTTRI"
     atggaaatac catcgacgtt ccgacacgcg ccctggagcg ccggaacgct tgaccaatgc        60
     ggagcaaaac gcatgagtgt cggaaccgct ctcgaacaat tgctccggct gattcatcgc       120
     cgagccatga aattggcgat gttgccggaa gatgaaaggg attctcacta cgatcgcatc       180
     cgcctgtcat gttgtgcggc cgccgagcac attgggcaag atcccgacca ggcagccatc       240
     acggcgaacg atatggttga gtttgttcgc gcgctggtcg gaatcattga aatgggctct       300
     ggaccggatc atgagcgaaa cgccgatcag cggtcgccga tgctgccttc gggcggtcaa       360
     gagcatgtca ccacgcgcat ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page