(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0168

BA000012.MLR0168     Location/Qualifiers
FT   CDS_pept        118263..118808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0168"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47810"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47810"
FT                   /db_xref="GOA:Q98NF1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF1"
FT                   /protein_id="BAB47810.1"
FT                   /translation="MKRDEGGDAADLTEIAGAIKWFDVAKGYGFILPDDGVSGDILLHV
FT                   TCLRRDGFQTALEGARVVCLVKQGDRGLQAFRVLSMDVTTAVHPAEMQEQRTHVAVTPE
FT                   SGLERALVKWFNRTKGFGFLTRGEGTEDIFVHMETLRRYGITELRPGQVVLVRFGRGDK
FT                   GLMAAEIHPDMGTLPVSH"
     ttgaagcgcg acgaaggcgg cgatgccgcc gacctgaccg aaattgccgg cgccatcaag        60
     tggttcgatg tggccaaagg ttacgggttc atcctacccg atgacggtgt ctcgggcgat       120
     atcctcctcc atgtgacatg tcttcgacgg gacggtttcc aaactgccct ggagggcgcg       180
     cgcgtggtct gccttgtcaa gcagggcgat cgcggtctgc aggctttccg tgtgctttcc       240
     atggatgtca ccaccgccgt ccatcccgcg gaaatgcagg aacagcgcac gcatgtcgcg       300
     gtgacgccgg agagcgggct tgaacgcgct ttggtcaagt ggttcaaccg caccaagggc       360
     ttcggcttcc tgacgcgtgg cgaaggcacc gaggacattt tcgtccatat ggagaccttg       420
     cgccgttatg gcatcaccga gcttcggccg gggcaggtcg tgcttgtccg tttcggccgc       480
     ggtgacaaag gccttatggc cgccgaaatt caccccgata tgggcacctt gccggtttcg       540
     cactag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page