(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0169

BA000012.MLR0169     Location/Qualifiers
FT   CDS_pept        118983..119393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0169"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47811"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47811"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF0"
FT                   /protein_id="BAB47811.1"
FT                   /translation="MTKDGNRSFSIEIADTDAEREAGLMFRQDMADDHGMLFVFEIQQQ
FT                   VSFWMQNTPMPLDLIFVGQDGKIRAVKHGEPQSQAIISPGVPVRFVLELKAGAAAKYGI
FT                   GYGDLLRHPAIGTVSGPGMPPPDNGDAPNGGG"
     gtgacgaaag acgggaatcg ctctttttcc atcgaaatcg ccgacaccga tgcggagcgc        60
     gaggccggcc tgatgtttcg ccaggacatg gcggacgatc acggcatgct gttcgttttc       120
     gagatacagc agcaggtcag cttctggatg cagaacacgc cgatgccgct tgacctgatc       180
     tttgtcggcc aggatggcaa gatccgcgcc gtcaagcatg gcgagccgca atcccaggcc       240
     atcatttcac ctggcgtgcc cgtgcgcttc gtgctcgagc tcaaggctgg cgccgccgcc       300
     aaatacggca tcggatatgg cgacctgttg cgccacccgg caatcggcac cgtatccgga       360
     ccaggcatgc caccgccgga caatggcgat gcacccaacg gcggcggctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page