(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0180

BA000012.MLR0180     Location/Qualifiers
FT   CDS_pept        124438..124965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0180"
FT                   /product="ferripyochelin binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47820"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47820"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE1"
FT                   /protein_id="BAB47820.1"
FT                   /translation="MPLYAIDGAEPSFADAGSNWIAPDATLIGDIRVGRNAGFWFGVVI
FT                   RGDNEPIIVGADTNVQEHTVMHTDPGFPLTIGEGCTIGHRAMLHGCTIGDNSLIGMGAI
FT                   VLNGARIGKNSLVGAGALVTEGKEFPDNSLIVGSPAKAIRVLDDAAVERLRGSAAHYVA
FT                   NGKRFKAGLKKV"
     atgccgcttt atgcgatcga tggagcggag cccagcttcg ccgatgccgg ctcgaactgg        60
     atcgcgcccg atgcaacgct gatcggcgac atcagggtcg gccgcaatgc cggcttctgg       120
     ttcggcgtcg tcattcgcgg cgacaatgag ccgatcattg tcggcgccga caccaatgtg       180
     caggaacaca cggtcatgca caccgatccc ggctttccgc tgaccatcgg cgagggctgc       240
     acgattggcc atcgggccat gctgcatggc tgcacgatcg gcgacaacag cctgatcggc       300
     atgggcgcca tcgtgctgaa cggcgccagg atcggcaaga attcgctggt cggcgccggc       360
     gcgctggtca ccgaaggcaa ggagtttccg gacaattcgc tgatcgtcgg ctctccggcc       420
     aaggcgatca gggtgctgga cgatgcggcc gtcgaaagat tgcgcggctc ggccgcgcac       480
     tacgtcgcca atggcaagcg cttcaaggcg gggctgaaga aggtctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page