(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0187

BA000012.MLR0187     Location/Qualifiers
FT   CDS_pept        128607..129320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0187"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47825"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47825"
FT                   /db_xref="GOA:Q98ND6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND6"
FT                   /protein_id="BAB47825.1"
FT                   /translation="MPPPAREPVFNLPPIVLAVIGICAAVFLLQQYVLNDAQQITLLYD
FT                   GAFIPVLYTGQYGFDWFLFTRPFTYAFMHGGFAHIAINMVWLAAFGSPLANRLGGLRFA
FT                   LFFAVTGLASVALFWAMHPYGEAPLVGASGAISGMMGAAARFGFRTDRSAGKAAFAGPV
FT                   LPISLVVRSRGVVVFLAVWMIINLATGLLGFAPGVDGQIAWEAHIGGFVAGFFGLRWFD
FT                   RRWPPPEWETADRRT"
     atgccgccgc ctgcgcgcga accggtgttc aatctgccgc cgatcgtact ggcggtgatc        60
     ggcatttgcg cggccgtctt cctgctgcag caatatgtgc tgaacgacgc gcagcagata       120
     acgctgctct acgatggagc cttcattcca gtcctctata ccgggcaata cggcttcgac       180
     tggttcctgt tcacacgacc cttcacctat gccttcatgc atggcgggtt tgcccatatc       240
     gccatcaata tggtgtggct cgccgccttt ggttcgccac tagccaatcg gctcggcggg       300
     ctccggttcg ctctgttctt cgctgttacc ggactggctt ccgtggcgct cttctgggcc       360
     atgcacccct atggtgaagc accgctggtc ggcgcctccg gtgccatatc aggcatgatg       420
     ggtgccgcgg cgcgcttcgg tttccgcacc gaccgttcgg ccggcaaggc ggccttcgcc       480
     ggccccgtgc tgccgatctc gcttgtcgtg cgttcgcgcg gtgtcgtggt cttccttgcc       540
     gtgtggatga tcatcaacct cgccacaggc ctgctcggat ttgcgcctgg agtagatggg       600
     cagatcgcct gggaggctca tattggtggc ttcgtcgccg gctttttcgg cctgcgctgg       660
     ttcgatcggc gatggccgcc gcccgaatgg gagaccgccg accgtcgcac ttga             714
//

If you have problems or comments...

PBIL Back to PBIL home page