(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0215

BA000012.MLR0215     Location/Qualifiers
FT   CDS_pept        149749..152205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0215"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47847"
FT                   /db_xref="GOA:Q98NB4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB4"
FT                   /protein_id="BAB47847.1"
FT                   /translation="MIRLIGYFFGIGTTLALLVAAGVAIYISHLSKDLPDYEVLAKYEP
FT                   PVTTRIHASDGSLMAEYARERRLYLPIQAIPDRVKAAFLSAEDKNFYNHPGIDVTGLGR
FT                   AIIVNLQNFGSGRRQVGASTITQQVAKNFLLTADQTYERKIKEMILAFRIEQAYPKDRI
FT                   LELYLNEIFFGFGAYGVAGAALTYFDKSVNELTVAEAAYLASLPKGPNNYHPFKHADRA
FT                   IERRNWVIDQMVENGYVTREEGNKAKAEPLGVTPRRTGTYLFAGEYFTEEVRRQIIARY
FT                   GENALYEGGLSVRTTLDPKVQLIARKAMQNGLIKYDTLRGYRGPVTSIDVSGDWGVPLG
FT                   AVKGLEDVPEWSLAVVLDSSASGLSIGLQPARQASGDIVKERVEGTVSKDDMGFAMRHM
FT                   VDGKTVKAKSPADVLKPGDVIFVQKNEGSDNTYSLRQVPEVEGGLIAMDPHTGRVLAMV
FT                   GGFSYAQSEFNRATQAMRQPGSSFKPIVYSAALDNGYTPASVIMDGPITIQSGNTTWTP
FT                   KNYDGTVAGPATLRSGIEKSRNLMTVRLANDMGMKLVVEYAERFGVYDHLAPYLPMALG
FT                   SGETTVMRMVSAYSIMANGGKSIKPSLIDRIQDRYGKTVFKQDERGCEGCNALEWKNQP
FT                   EPELVDNSEQVLDPMTAYQITSMMEGVVQRGTGATIGELGRHIAGKTGTTNDEKDAWFI
FT                   GFTPNLVVGLYMGYDTPRGLGHGATGGGLAAPIFKDFMRVALDGTPNVDFKVPDGMNLI
FT                   AINRKTGMRAASGDPGTIIEAFKPGTGPADSYWVIGMGADGSNASGGALSPQANQAIQD
FT                   GGGGLY"
     atgattcgtc tcattggcta tttcttcggc atcggcacga cgctggccct tctggtcgcg        60
     gcgggcgttg ccatttacat cagccatctg tcgaaggatc tgcccgacta cgaggtgctg       120
     gccaaatacg agccgccggt gaccacccgc attcacgcct cggacggctc gctgatggcc       180
     gaatatgcgc gcgagcggcg gctatatttg ccgatccagg ccatcccgga tcgcgtcaag       240
     gcggccttcc tgtcggcgga agacaagaac ttctacaatc accccggcat cgacgtgacc       300
     ggccttggcc gcgccatcat cgtcaacctg cagaattttg gctcgggcag gcgccaggtc       360
     ggcgcctcga cgatcaccca gcaggtggcc aagaacttcc tgttgaccgc ggaccagacc       420
     tacgagcgca agatcaagga aatgatcctg gccttccgca tcgagcaggc ctaccccaag       480
     gatcgtatcc tcgagctcta cctcaacgaa atcttcttcg gtttcggcgc ctacggtgtc       540
     gccggcgcgg cgctcaccta cttcgacaag tcggtgaacg aactgaccgt ggccgaggcc       600
     gcctacctgg cttcgttgcc gaagggcccc aacaactacc atcctttcaa gcatgccgat       660
     cgcgcgatcg agcgccgcaa ctgggtcatc gaccagatgg tcgaaaatgg ctacgtcacg       720
     cgtgaggaag gcaacaaggc caaggccgag ccgctcggcg tgacgccgcg ccgtaccggc       780
     acctatctgt tcgccggcga atacttcacc gaagaggtgc gccgccagat catcgcccgt       840
     tacggcgaga acgcgctcta cgaaggcggc ctgtccgtcc gcaccacgct tgatccgaaa       900
     gtccagctca tcgcccgcaa ggcgatgcag aacggcttga tcaaatacga tacgctgcgc       960
     ggctatcgcg ggccggtgac gtcaatcgac gtgtccggcg actggggcgt cccgctgggc      1020
     gccgtcaagg gactggagga cgtccccgaa tggtcgctgg ccgtcgtgct cgactcctcc      1080
     gcgtcaggtc tctcgatagg cctgcagccc gcacgccagg catcgggcga catcgtcaag      1140
     gaacgcgtcg aaggcactgt cagcaaggac gacatgggct ttgccatgcg ccatatggtg      1200
     gacggcaaga cggtaaaggc caagtcgccg gccgatgtgc tgaagcccgg cgacgtcatc      1260
     ttcgtgcaga agaacgaagg ctccgacaac acctacagcc tgcgccaggt tcccgaggtg      1320
     gaaggcggcc tgatcgccat ggatccgcac accggccgtg tgctggccat ggtcggcggt      1380
     ttctcctatg cgcagtccga attcaaccgc gccacccagg cgatgcgtca gccgggctcc      1440
     tcgttcaagc cgatcgtcta ctcggcggcg ctcgacaatg gctatacgcc ggcctcggtg      1500
     atcatggacg gaccgatcac catacagagc ggcaacacga cctggacgcc gaagaactat      1560
     gacggcaccg tcgccgggcc ggcaacgctg cgttccggca tcgagaagtc gcgcaatttg      1620
     atgacggtgc ggcttgccaa cgacatgggc atgaagctgg tcgtcgaata tgccgagcgc      1680
     tttggtgtct acgatcatct ggcgccgtat ctgccgatgg cgctgggctc cggcgagacc      1740
     accgtgatgc gcatggtttc ggcctattcg atcatggcca atggcggcaa gtcgatcaaa      1800
     ccgtcgctga tcgaccgcat ccaggaccgc tacggcaaga ccgtgttcaa gcaggatgag      1860
     cgtggctgcg aaggctgcaa cgcgcttgaa tggaagaacc agccagagcc ggaactggtc      1920
     gacaattccg agcaggtgct cgatccgatg accgcttatc agatcacctc gatgatggaa      1980
     ggcgtggtcc agcgcggcac cggcgccacc attggcgaac tcggccgcca cattgccggc      2040
     aagacaggca ccaccaacga cgaaaaggac gcctggttca tcggtttcac gccgaacctc      2100
     gtggttggcc tctacatggg ctacgacacg ccgcgcggcc ttggccacgg cgccaccggt      2160
     ggcggtctcg ccgccccgat cttcaaggat ttcatgcgcg ttgcgctgga cggcacgccc      2220
     aacgtcgact tcaaggtccc agacggcatg aacctgatcg ccatcaatcg taagaccggc      2280
     atgcgtgccg cgtcgggcga tccgggcacc atcatcgagg ccttcaagcc gggcaccggt      2340
     cccgccgaca gctattgggt gatcggcatg ggtgccgacg gctccaacgc gtcgggcggc      2400
     gcactgtcac cgcaggccaa ccaggccatc caggacggcg gcggcggcct ctactga         2457
//

If you have problems or comments...

PBIL Back to PBIL home page