(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0220

BA000012.MLR0220     Location/Qualifiers
FT   CDS_pept        154684..155334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0220"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47852"
FT                   /db_xref="GOA:Q98NA9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA9"
FT                   /protein_id="BAB47852.1"
FT                   /translation="MKKTVLVAVATALLVSACTTTDPYTGDQKISNTAAGAGLGALAGA
FT                   SLGLLAGGNDRRNALIGAGIGALAGGAIGATMDQNEAELRRQLEGTGVSVTRSGDQIIL
FT                   NMPSDITFNVDQDAVKPGFYPVLNSVALVLKKFKQTTVDVFGHTDSTGGDQHNFDLSQR
FT                   RALAVANYLSGQGVDQRRFAVTGFGKTRPIASNATAAGREQNRRVEIQLSPLT"
     atgaagaaga ccgtgctcgt cgccgtggcg acggctttgc tcgtgagcgc atgcaccacc        60
     accgatccgt atacgggcga ccagaagatt tccaacacag ccgcaggtgc cggtctcggc       120
     gccctggcag gtgccagcct tggtctgctt gccggcggca acgaccgccg caacgcgctg       180
     atcggcgccg gcatcggtgc gcttgccggc ggcgccatcg gcgccaccat ggatcagaac       240
     gaagctgaac tgcgccggca gctcgagggc accggtgtca gcgtcacccg cagtggcgac       300
     cagatcatcc tcaacatgcc gtcggacatt accttcaatg tcgatcagga tgcggtgaag       360
     cccggcttct atccggtgct gaactcggtt gcgctggtgt tgaagaaatt caagcagacc       420
     acggtcgatg ttttcggtca caccgattcg accggcggcg accagcacaa tttcgatctg       480
     tcgcagcgcc gcgcactcgc ggttgccaac tatctgtccg gtcagggcgt cgatcagcgc       540
     cgcttcgccg tcaccggctt cggcaagacg cgaccgatcg catccaatgc gacggctgcc       600
     ggccgcgagc agaaccgtcg cgtcgagatc cagttgtcgc cgctcacctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page