(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0283

BA000012.MLR0283     Location/Qualifiers
FT   CDS_pept        204878..205249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0283"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47901"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47901"
FT                   /db_xref="GOA:Q98N61"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N61"
FT                   /protein_id="BAB47901.1"
FT                   /translation="MPTVNQLIRKPRIAPVKRNKVPAMQQNPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDT
FT                   QGVKNRKQRRSKYGAKRPK"
     atgcctaccg tcaaccagct gatccgcaag ccgcgcattg cgccggtgaa gcgcaacaag        60
     gtcccggcca tgcagcagaa cccgcagaag cggggcgtct gcacgcgcgt ctacacgacg       120
     acgccgaaga agccgaactc ggcgctgcgc aaggtggcca agatccgcct gaccaatggt       180
     tttgaagtga tcggttacat ccccggcgaa ggtcacaacc ttcaggaaca ctccgtggtc       240
     atgatccgcg gcggccgcgt caaggatctt ccgggcgttc gctaccacat catccgcggc       300
     gtgctcgaca cgcagggcgt gaagaaccgc aagcagcgcc gttcgaagta cggcgccaag       360
     cgtccgaagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page