(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0286

BA000012.MLR0286     Location/Qualifiers
FT   CDS_pept        205810..207900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0286"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47903"
FT                   /db_xref="GOA:Q98N59"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N59"
FT                   /protein_id="BAB47903.1"
FT                   /translation="MAREYKIEDYRNFGIMAHIDAGKTTTTERVLYYTGKSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWKGRDGKMRRFNIIDTPGHVDFTIEVERSLRVL
FT                   DGAIALLDANAGVEPQTETVWRQADKYRVPRMIFCNKMDKIGADFYRSVEMIGSRLGAQ
FT                   AVVMQLPIGAETEFKGVVDLVEMNALVWRDETLGAAWDVVEIPADLQARAQEYREKMIE
FT                   AAVEMDETALENYLEGKMPSNDEIRSLIRKGTIAVKFFPMFCGSAFKNKGVQPLLDAVV
FT                   EYLPSPADVPAIKGVDAKTDAEIERHAVDDEPLSMLAFKIMNDPFVGSLTFARIYSGKL
FT                   TKGISVDNTVKGKKERIGRMLQMHANSRADVEEAFAGDIVALAGLKDTTTGDTLCDPLH
FT                   PVILERMEFPDPVIQIAIEPKTKNDQEKMGLALHRLAAEDPSFRVKTDEESGQTIISGM
FT                   GELHLDIIVDRMRREFKVEANVGAPQVAYRETITRKHEQDYTHKKQTGGTGQFARVKVL
FT                   FEPNTESEEFVFESKIVGGAVPKEYIPGVEKGIQSVMGAGPFAGFPMIGVRATLIDGAY
FT                   HDVDSSVLAFEIASRACFREAAPKLGVQLLEPIMKVEVVTPEDYVGSVIGDLNGRRGQI
FT                   QGQEARGVAVVINAMVPLANMFKYVDNLRSMSQGRAAYTMQFDHYEPVPTAVAQEVQKK
FT                   YA"
     atggcccgcg aatacaaaat cgaagactac cgcaatttcg gtatcatggc gcatattgac        60
     gccggcaaga cgacgaccac cgagcgcgtc ctctattaca cgggcaagtc gcacaagatc       120
     ggcgaagtgc acgacggcgc tgccaccatg gattggatgg agcaggagca ggaacgcggc       180
     atcaccatca cgtccgccgc caccacgacc ttctggaaag gccgtgacgg caagatgcgc       240
     cgcttcaaca tcatcgacac tcccggacac gtcgacttca ccatcgaagt cgagcgttcg       300
     ctgcgcgtgc tcgacggcgc catcgcgctg ctcgacgcca acgccggtgt cgagccgcag       360
     acggaaaccg tctggcgcca ggccgacaag taccgcgttc cgcgcatgat cttctgcaac       420
     aagatggaca agatcggcgc cgacttctac cgctcggtcg agatgatcgg ctcgcgcctc       480
     ggtgcgcagg ctgtcgtcat gcagctgccg atcggcgccg agaccgaatt caagggcgtc       540
     gtcgacctcg ttgagatgaa tgcgcttgtc tggcgcgacg agacgctggg cgccgcctgg       600
     gacgtcgtcg agatcccggc cgaccttcag gctcgtgccc aggaataccg cgagaagatg       660
     attgaagccg ccgtcgaaat ggacgagacg gccctcgaga actacctcga aggcaagatg       720
     ccttcgaatg acgagatccg ttcgctgatc cgcaagggca cgatcgcggt caagttcttc       780
     ccgatgttct gtggctcggc cttcaagaac aagggcgtgc agccgctgct cgacgcagtc       840
     gtcgaatacc tgccgtcgcc ggccgacgtt cccgccatca agggcgtcga tgccaagacc       900
     gatgccgaga tcgagcgcca cgcggtcgac gacgagcctc tctcgatgct tgccttcaag       960
     atcatgaacg acccgttcgt cggttcgctg accttcgccc gcatctattc gggcaagctc      1020
     accaagggca tctcggtcga caacaccgtc aagggcaaga aggagcgcat cggccgcatg      1080
     ctgcagatgc atgcgaattc gcgcgccgac gtcgaagaag ctttcgccgg cgacatcgtc      1140
     gctctggccg gcctcaagga cacgaccact ggcgatacgc tgtgcgatcc gttgcatccg      1200
     gtcatcctcg agcgcatgga attcccggat ccggtcatcc agatcgccat cgagccgaag      1260
     accaagaacg accaggaaaa gatgggcctc gcccttcacc gcctggctgc cgaggatccg      1320
     tccttccgcg tcaagaccga cgaggaaagc ggccagacca tcatctccgg catgggcgaa      1380
     ctgcacctcg acatcatcgt cgaccgcatg cgtcgcgagt tcaaggtcga agccaatgtc      1440
     ggcgctccgc aggtggccta tcgcgagacg atcacccgca agcacgagca ggactacaca      1500
     cacaagaagc agaccggcgg taccggccag ttcgcccgcg tcaaggttct gttcgagccg      1560
     aatacggaga gcgaagagtt cgtcttcgag tccaaaatcg tcggcggcgc ggtgccgaag      1620
     gaatacattc cgggtgtcga aaagggcatc cagagcgtca tgggcgctgg tccgttcgcg      1680
     ggcttcccga tgatcggtgt tcgtgcgacg ctgatcgacg gcgcctacca cgacgtcgac      1740
     tcctcggtcc tggccttcga aatcgcgtcc cgcgcctgct tccgtgaagc cgcacccaag      1800
     cttggcgtgc agctgctcga gccgatcatg aaggtcgaag ttgtgacgcc ggaagactat      1860
     gtcggcagcg tcatcggcga cctgaacggc cgccgcggcc agatccaggg ccaggaagcg      1920
     cgcggcgtgg ccgtcgtcat caacgcgatg gtgccgctcg ccaacatgtt caagtacgtc      1980
     gacaacctgc gctcgatgag ccagggccgc gcggcctaca cgatgcagtt cgaccactac      2040
     gagccggtcc cgaccgcggt cgcccaggaa gtccagaaaa aatacgcgta a               2091
//

If you have problems or comments...

PBIL Back to PBIL home page