(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0291

BA000012.MLR0291     Location/Qualifiers
FT   CDS_pept        209583..210296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0291"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47906"
FT                   /db_xref="GOA:Q98N57"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N57"
FT                   /protein_id="BAB47906.1"
FT                   /translation="MRSGVIAKKVGMTRIYNDAGEHVPVTVLQMENCQVVAQRTQEKNG
FT                   YTAVQLGVGLAKVKNTSKAMRGHFATASVEPKAKVAEFRVSADNMIDVGAEITVEHFVA
FT                   GQKVDVTGTTIGKGFQGVIKRHHMGGGRATHGNSVSHRTHGSTGQRQDPGKVFKGKKMA
FT                   GHMGDTRVTTQNVEIVSTDADRGLILIRGAVPGSKGAWILVRDAAKVALPANAPKPAAI
FT                   RAAVKNEAPATEGAE"
     atgcgttcag gtgtgattgc aaagaaggtg ggaatgaccc gcatctataa cgatgccggg        60
     gaacatgttc ccgtcaccgt tctccagatg gagaactgcc aggtcgtggc gcagcgcacg       120
     caggagaaga atggctacac cgccgttcag ctcggcgttg gcctcgccaa ggtgaagaac       180
     acgtcgaagg cgatgcgcgg ccatttcgcg accgcttccg tcgagccgaa ggcgaaggtt       240
     gccgagttcc gcgtctcggc cgacaacatg atcgatgtcg gcgccgagat caccgtcgag       300
     cacttcgtcg ccggccagaa ggtcgacgtg acgggcacga cgatcggcaa gggtttccag       360
     ggcgtcatca agcgtcacca catgggtggt ggccgcgcga cgcacggtaa ctcggtctcg       420
     caccgtacgc acggttcgac cggccagcgc caggaccccg gcaaggtgtt caagggcaag       480
     aagatggccg gccacatggg cgacacccgc gtgacgacgc agaatgtcga gatcgtctcg       540
     accgatgccg accgcggcct gatcctgatc cgcggagcgg ttcccggatc gaagggcgct       600
     tggatcctgg tccgcgatgc ggccaaggtg gcactgccgg ccaatgcgcc gaagcccgcc       660
     gcgatccgcg ccgctgttaa gaacgaggct ccggccacag agggagcgga ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page