(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0295

BA000012.MLR0295     Location/Qualifiers
FT   CDS_pept        211229..212062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0295"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47909"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47909"
FT                   /db_xref="GOA:Q98N54"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N54"
FT                   /protein_id="BAB47909.1"
FT                   /translation="MALKKFNPVTPSTRQLVIVDRSGLYKGKPVKGLTEGLTKSGGRNN
FT                   YGRITARFIGGGHKRSYRIIDFKRRKFDVVGTVERIEYDPNRTAFIALIKYDDGELSYI
FT                   IAPQRLAAGDKIVAGEAVDVKPGNAMPLASMPVGTIVHNIELKPGKGGQVARSAGGYAQ
FT                   LVGRDQGMAILRLNSGEQRVVHGSCMATVGAVSNPDHGNINDGKAGRTVWRGKRPHNRG
FT                   VTMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGKKTRSNKATDKFILRSRHQRKS"
     atggcactga aaaaattcaa cccggtaacg ccgagcaccc gccagctggt catcgtcgac        60
     cgctcgggcc tttacaaggg caagcccgtc aagggtctga ccgagggcct gaccaagtcg       120
     ggcggccgca acaattacgg ccgcatcacc gcccgcttca tcggcggtgg tcacaagcgt       180
     tcgtaccgca tcatcgactt caagcgccgc aagttcgacg tcgtcggcac ggtcgagcgc       240
     attgaatacg atccgaaccg caccgccttc atcgcgctga tcaagtacga tgatggtgag       300
     ctgtcctaca tcatcgcccc gcagcgcctt gccgccggcg acaagatcgt ggctggcgaa       360
     gcggtcgacg taaagccggg caatgcgatg ccgctggcct cgatgccggt cggcacgatc       420
     gtccacaaca tcgagctgaa gccgggcaag ggcggtcagg tcgcccgttc ggctggcggt       480
     tacgctcagc tcgtcggtcg cgaccagggc atggcgatcc tgcgcctcaa ctcgggtgag       540
     cagcgtgtcg ttcacggctc ctgcatggcc accgtcggtg ccgtgtcgaa ccccgaccac       600
     ggcaacatca acgacggcaa ggccggccgc acggtttggc gcggcaagcg tccgcacaat       660
     cgcggcgtga ccatgaaccc ggtcgaccat ccgcacggcg gtggtgaagg ccgcacctcc       720
     ggcggccgcc atccggtcag cccgtggggc aagccgacca agggcaagaa gacgcggtcc       780
     aacaaggcga ccgacaagtt catcctgcgc tcgcgccatc agcgcaagag ctaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page