(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0301

BA000012.MLR0301     Location/Qualifiers
FT   CDS_pept        213502..213915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0301"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47913"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47913"
FT                   /db_xref="GOA:Q98N50"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N50"
FT                   /protein_id="BAB47913.1"
FT                   /translation="MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAR
FT                   EIEAARRAITREMKRAGRVWIRIFPDLPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMF
FT                   EIDGVSEETAREALRLGAAKLSVRTRFVQRIAE"
     atgctgcagc caaagcgcac aaagttccgc aagcagttca agggccgtat ccatggtacc        60
     gcaaagggcg gcaccaacct ggatttcggt ggtttcgggc tgaaggcgct tgagccgaac       120
     cgcgtcaccg cgcgtgagat cgaggcggcc cgccgcgcga tcactcgcga aatgaagcgc       180
     gctggccgcg tctggatccg cattttcccg gatctgccgg tcacgtcgaa gccgaccgaa       240
     gtccgcatgg gcaagggcaa gggtgccgtc gactactggg cggcgcgcgt caagccgggg       300
     cgcatcatgt tcgagatcga cggcgtcagt gaagaaaccg cccgtgaggc gctgcgtctc       360
     ggcgcggcca agctctcggt caggacgcgc ttcgtacagc gcatcgcaga ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page