(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0306

BA000012.MLR0306     Location/Qualifiers
FT   CDS_pept        214846..215160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0306"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47917"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47917"
FT                   /db_xref="GOA:Q98N46"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N46"
FT                   /protein_id="BAB47917.1"
FT                   /translation="MQKIRKGDKVVVLAGKDKGRSGEVLSVQPKDDTALVRGVNMIRRH
FT                   QKQSQSQEGGIITKEAPIQLSNIALADPKDGKPTRVGFIFQKDGKKVRVAKRSGEVING
FT                   "
     atgcaaaaga ttagaaaagg cgacaaggtc gtcgtgctgg ccggcaagga caagggccgt        60
     tcgggcgaag tcctctcggt tcagccgaag gatgacaccg cgctggtgcg cggcgtcaac       120
     atgatccgtc gtcaccagaa gcagtcccag tcccaagagg gcgggatcat caccaaggaa       180
     gcgccgatcc agctgtcgaa catcgcgctg gccgacccca aggatggcaa gccgacccgc       240
     gtcggtttca tcttccagaa ggacggcaag aaggtgcgcg tcgccaagcg ctcgggagaa       300
     gtcatcaatg gctaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page