(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0312

BA000012.MLR0312     Location/Qualifiers
FT   CDS_pept        216564..217097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0312"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47921"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47921"
FT                   /db_xref="GOA:Q98N42"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N42"
FT                   /protein_id="BAB47921.1"
FT                   /translation="MSRIGKKPVSLPQGVTATVNGQTVTAKGPKGELKFVVNDEVLVKM
FT                   EGSEIAVQPRDQTKTARSKWGMSRTQIVNILHGVKDGFEKKLEITGVGYRAAMQGKNLQ
FT                   LALGFSHDVVYETPAGVTIAVPKPTEITVTGIDKQQVGQVAAEIREYRGPEPYKGKGVR
FT                   YAGEKIVRKEGKKK"
     atgtctcgta ttggaaagaa acccgtttcg ctgccgcagg gcgtgaccgc gaccgtcaac        60
     ggccagaccg tgacggcgaa gggccccaag ggcgagctga agttcgtggt gaacgacgaa       120
     gtcctggtca agatggaagg cagcgagatc gctgttcagc cgcgcgacca gaccaagacc       180
     gcccgctcca agtggggcat gtcgcgcacg cagatcgtca acatcctgca cggcgtcaag       240
     gacggcttcg agaagaagct cgagatcacc ggcgtcggct atcgcgccgc catgcagggc       300
     aagaacctgc agctggctct tggcttcagc catgacgtcg tctatgagac gccggccggt       360
     gtcaccatcg ctgtgccgaa gccgacggaa atcaccgtga ccggcatcga caagcagcag       420
     gttggccagg tcgcggccga gatccgcgag tatcgcggtc cggagcccta caagggcaag       480
     ggcgttcgtt acgctggcga gaagatcgtc cgcaaggaag gcaagaagaa gtag             534
//

If you have problems or comments...

PBIL Back to PBIL home page