(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0325

BA000012.MLR0325     Location/Qualifiers
FT   CDS_pept        222276..223286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0325"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47930"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47930"
FT                   /db_xref="GOA:Q98N33"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N33"
FT                   /protein_id="BAB47930.1"
FT                   /translation="MIQKNWQELIKPNKIEFSSKKKTLTTLVAEPLERGFGLTLGNALR
FT                   RVLLSSLRGAAVTAVQIDGVLHEFSSIAGVREDVTDIVLNIKEIAIRMEGDGPKRMVVR
FT                   KQGPGAVLAGDIQTVGDVEILNPDHVICTLDEGAEIRMEFTVDTGKGYVPAERNRAEDA
FT                   PIGLIPVDSLYSPVKKVSYKVENTREGQVLDYDKLTMTIETDGSISGEDAVAFAARILQ
FT                   DQLGLFVNFDEPQKEVAAEAVTELAFNPALLKKVDELELSVRSANCLKNDNIVYIGDLI
FT                   QKTEAEMLRTPNFGRKSLNEIKEVLAAMGLHLGMEVPDWPPENIEDLAKRYEDQY"
     atgatccaga aaaattggca ggaactgatc aagccgaaca agatcgagtt ctcgtcgaag        60
     aagaagacgc tgaccacgct ggtcgccgag ccgctcgagc gtggctttgg cctcaccctc       120
     ggcaacgcgc tgcgccgcgt gcttctgtct tcgctgcgcg gtgcggctgt gaccgctgtg       180
     cagatcgacg gcgttctgca tgaattctcg tctatcgccg gcgtgcgcga ggacgtgacc       240
     gacatcgtct tgaacatcaa ggagatcgcc atccgcatgg aaggcgatgg ccccaagcgc       300
     atggtcgtgc gcaagcaggg accgggtgcg gttctcgccg gcgacatcca gacggttggt       360
     gacgttgaga tcctcaaccc cgaccacgtc atctgcacgc tggacgaagg cgctgaaatc       420
     cgcatggaat tcaccgtcga caccggcaag ggttacgtgc cggccgagcg caaccgcgcc       480
     gaggacgcgc cgattggcct gatcccggtc gacagcctct attcgcccgt caagaaggtc       540
     tcctacaagg tcgaaaacac ccgcgagggc caggttctcg actatgacaa gctgaccatg       600
     acgatcgaga ccgacggttc gatctcgggc gaggacgcag tggccttcgc cgcccgcatc       660
     ctgcaggacc agctcggcct gttcgtcaac ttcgacgagc cgcagaagga agtcgccgcc       720
     gaagccgtca ccgagctcgc cttcaacccg gcgctgctca agaaggtcga cgaacttgaa       780
     ctttcggtgc gttcggccaa ctgcctgaag aacgacaaca tcgtctacat cggcgatctc       840
     atccagaaga ccgaagccga gatgctgcgc accccgaact tcggccgcaa gtcgctgaac       900
     gagatcaagg aagtcctggc ggcgatgggc ctgcacctcg gcatggaagt gccggattgg       960
     ccgccggaaa acatcgaaga cctcgccaag cgttacgaag accaatattg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page