(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0331

BA000012.MLR0331     Location/Qualifiers
FT   CDS_pept        227581..228516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0331"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47935"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47935"
FT                   /db_xref="GOA:Q98N28"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N28"
FT                   /protein_id="BAB47935.1"
FT                   /translation="MRRPKKPYQGARPGGGRCRDWAHSFATGSRSARGKMTKTLRKSLR
FT                   KFAIAIPLLALGFYFIPILTTIFIVCGLIDVLRNDRKDLALFSGYFLGNGLFTWLLSPF
FT                   NLLVDLLCYRNPGVWKLEQFPEDYQREVNEVLDIFRARKDEIIADIDANFGVGRRGMYV
FT                   YQWYGKHRIDNVAEFNKDFKYIKTIAVSVFSKRESTSWHFGPLRLSLRILYNLVPVKAE
FT                   IFVECGNVKNYWYDNPQFIFDDTLLHRSVNEYDGRRYCVFMDIIRPSPFPRLIAGMLAI
FT                   VSVSVERINSMFYKNWKMIGSTKPKKVETT"
     gtgcggcgac ccaaaaaacc ttatcaaggc gcacggccgg gcggtggtcg ttgccgagat        60
     tgggcacact cattcgcaac aggatcgcgc tccgcgcgtg gaaaaatgac aaaaaccctt       120
     cgcaagtccc ttcgcaaatt cgccatcgcc atcccgcttc tcgctcttgg cttctacttc       180
     atccccattc tgacgacgat cttcatcgtc tgcggcctga tcgacgtgct gcgcaacgac       240
     aggaaggatc tggcgctgtt ctcgggctat ttcctcggca acggcctgtt cacctggctc       300
     ttgtctccgt tcaacctgct ggtcgatctg ctctgctacc gcaatcccgg cgtgtggaag       360
     ctggagcagt ttccggagga ttatcagcgc gaggtcaatg aggtcctaga catcttcagg       420
     gcgcgcaagg acgagatcat cgccgacatc gatgccaatt tcggtgtcgg ccggcgcggc       480
     atgtatgtct accagtggta cggcaagcac cggatcgaca acgtcgccga gttcaacaag       540
     gatttcaaat acatcaagac catcgccgtt tcggtcttca gcaagcgcga atcgacctcc       600
     tggcatttcg gcccgctgcg gctcagcctg cgcatccttt acaatctggt cccggtgaaa       660
     gcggaaatct tcgtcgaatg cggcaacgtc aagaactact ggtacgacaa tccgcagttc       720
     attttcgacg acacgctgct gcatcgttcg gtcaacgaat atgacggccg ccgctactgc       780
     gtgttcatgg acatcatcag gccgtccccg ttcccgagac tcattgccgg catgctcgcg       840
     attgtctcgg tcagcgtcga gcgcatcaat tcgatgttct acaagaactg gaagatgatc       900
     ggctcgacca agccgaagaa ggtcgaaacc acctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page