(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0332

BA000012.MLR0332     Location/Qualifiers
FT   CDS_pept        228765..230420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0332"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47936"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47936"
FT                   /db_xref="GOA:Q98N27"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N27"
FT                   /protein_id="BAB47936.1"
FT                   /translation="MTKNKIFGFWTGTYLCTLLLGIAVSAAYINLEESVYYWDFAAYFN
FT                   MFNQQGALLVESPFEWLSQLGTSIATEDYGVAILVPLMPFHLVFGGSRLSFIAGIVAVY
FT                   LVPAVLLIGRISYQEAFSETPSRSWIAVWIAAFLYTPFWAPTLRGMPDIAGCLALTAAT
FT                   YFLWKSRFLTREPVIGGISVGACLWLAFMLRRWYAYGAIGITVSAAFFCLLQIARERDL
FT                   PALRNAALGGACAIFLIAATALNFQLPLIAKILQTSYADLYSGYKTTFVTQLGDVGSRL
FT                   SYLNWALIVVGLYISVVRRNRFAVFCAMASVLTFLVFIRTQDPERHHSLPMFLWLFPAY
FT                   AQAIVSIVSVPGLKSRWPTAAMTVVAGFAFLGTFFPAGRQLLSPVGFVFAGEATLPLRL
FT                   DNLPEYRRLIDDLVARMGPEDRFSVFASGPVMSDALLFGMKRDLVAHVGWICQVDSRDR
FT                   FQPDALKSRYVVVTDRPVTHLQPGAQICVTIPNQYILEGKGIGAAYRRIAQYQLSGGVE
FT                   GYLYEQVRPVSKAELDALYVEFRKKYPDWAAPEW"
     gtgacaaaga acaaaatctt cggattctgg acgggtacct acctgtgcac cttgttgctt        60
     ggaattgccg tcagcgccgc gtacataaat ctcgaagagt ccgtctacta ttgggacttc       120
     gcggcctatt tcaacatgtt caaccagcag ggcgcgctct tggtcgagag ccctttcgaa       180
     tggctgagcc aattgggcac ctccatcgcg acggaagatt acggcgtggc gatcctggtg       240
     cccctgatgc cgtttcacct tgttttcggt ggttcaaggc tttccttcat cgccggaata       300
     gtcgcggtct atctggtccc ggcggttctt ttgataggca gaataagcta tcaggaggcg       360
     ttctccgaga cgccgtcccg aagttggatc gccgtctgga tcgcggcctt cctgtacacg       420
     ccgttctggg cgccgacgct tcggggaatg cctgacattg ccggctgcct cgccctgacc       480
     gcggcaacct attttctctg gaaatccagg ttcctgaccc gcgaaccggt gataggcgga       540
     atatccgtcg gcgcctgcct gtggttggcg ttcatgctgc gccgctggta cgcctatgga       600
     gccataggga tcaccgtttc cgcggcattt ttctgtttgc tgcagatcgc aagggagcgg       660
     gatctgccgg ccttgcgcaa cgcggctctg ggcggcgcgt gtgcgatttt ccttattgcc       720
     gcgacggcgt tgaacttcca gctgccgctg atcgccaaga ttctgcaaac cagctacgcc       780
     gacctttaca gcggatacaa gacgaccttt gtcacccagc tcggtgacgt cggatcccgg       840
     ctcagctatc tgaactgggc gctgattgta gtgggcctct acatctcggt tgtgcgtcgc       900
     aacagatttg ccgtgttctg tgccatggcc tcggtgctca ccttcctggt tttcatccgg       960
     acgcaggacc cggaacgtca tcattccttg ccgatgtttc tttggctctt tcccgcctat      1020
     gcccaggcga tcgtttcgat cgtgtccgtg ccgggactga aatcacgatg gccgaccgcc      1080
     gcaatgaccg ttgttgccgg cttcgctttt ttgggcacgt tttttccggc cggccgtcag      1140
     ctgttgtccc cagtgggctt tgtcttcgcc ggggaagcta cgctcccact tcgcctcgac      1200
     aatctccccg aatacaggcg cctgatcgat gacctcgtcg ccagaatggg accggaggac      1260
     cgtttttcgg tctttgcgtc gggtcctgtg atgagcgacg ccctgttgtt cggcatgaaa      1320
     cgggaccttg ttgcccatgt cggatggatt tgtcaggtag acagtcgtga ccggttccaa      1380
     ccggacgcat tgaaatccag atatgtcgtc gtgaccgacc ggccggttac gcatctgcaa      1440
     ccgggcgcgc agatctgcgt cacgatcccg aaccagtata ttcttgaagg caagggcatc      1500
     ggtgccgcgt accggcgcat tgcgcagtac caattgtccg gcggtgtcga aggctatctc      1560
     tacgaacagg tacgcccggt cagcaaggcc gagctcgatg ccctctatgt tgaattcagg      1620
     aaaaagtatc cggactgggc agcgcctgaa tggtga                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page