(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0356

BA000012.MLR0356     Location/Qualifiers
FT   CDS_pept        252298..252870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0356"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47955"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47955"
FT                   /db_xref="GOA:Q98N08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N08"
FT                   /protein_id="BAB47955.1"
FT                   /translation="MNAMENGVLQDIEVTVTFLEMDAPPAVSPPVPYNRQVALLKTKDI
FT                   PLHFYRYLMDRVGRKWHWVNVLRLDDEELSAGIHREDRDIRVLYLDGAPAGFFDLKPHL
FT                   PDEVELAYFGMMEHATGQGIGRWFLGSAISAAWSHGPKRVTVQTCTLDHPAALPLYQKL
FT                   GFKPVAQKKEVVHPLPFAERSASVMRP"
     atgaacgcga tggaaaacgg tgtgctgcag gacattgaag tcacggtgac ttttctcgaa        60
     atggatgccc ctcccgccgt ctccccgcca gtgccctaca accgccaggt tgcgttgctg       120
     aagaccaagg acatcccctt gcatttctat cgctatttga tggaccgggt cgggcgcaaa       180
     tggcattggg tgaatgttct caggctggac gatgaggagc tttcggccgg catccaccgt       240
     gaggaccgcg acatcagggt gctctacctc gacggtgcgc cagccggctt ctttgacctc       300
     aagccgcatc tgcctgatga agtcgaactc gcctatttcg gcatgatgga acatgctacc       360
     gggcaaggta ttggccgatg gttcctgggc tcggcgattt cagccgcctg gtcgcatggg       420
     ccgaaacggg tgacggtgca gacctgcacg ctggaccatc cggcggctct gccgctctac       480
     cagaagctcg gcttcaagcc ggtcgcgcag aagaaagagg tcgtgcatcc gctgcctttc       540
     gccgagcgct cggccagcgt catgcgcccg tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page