(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0372

BA000012.MLR0372     Location/Qualifiers
FT   CDS_pept        264605..265495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0372"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47966"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ7"
FT                   /protein_id="BAB47966.1"
FT                   /translation="MTDRPTTGTHPLDHLVLPTGSLEVARARLTSLGFVVAPTGIHPFG
FT                   TENCCVFLADGTYLEPLAIGNEQAAIDATADGNVFVARDRLHRDSRGDEGFSAVALGTD
FT                   NADADHARFVDAGLSAGDTLSFSRAFTDTSGKSDTASFRLAFAATRGAPDAFLFACQRI
FT                   NAPMVDRTALQAHANGATGILEVVAISDQPAEQYRMISVAANDPAANGEGRTFLLPNAT
FT                   LSVLDAKSFTARFGIPAGSSTKLRFAAIVFAVRSIDVASSLLAANAIQHDIAGTDIVVR
FT                   PASGQGAAFIFREIP"
     atgaccgaca gaccaaccac cggcacgcat ccgcttgacc atctcgttct gccgaccggc        60
     agcctcgagg tggcgcgagc ccggctcact tcgctgggct tcgtcgtcgc gccgaccggt       120
     atccatccct ttggaacgga aaactgctgc gttttcctcg ctgacggcac ctatctcgag       180
     ccgctcgcga tcggcaatga acaggcagcg atcgacgcaa cggccgacgg caacgtcttc       240
     gtcgcgcgcg accgcctcca tcgcgacagc cgtggcgatg aggggttttc ggccgtggcc       300
     ctggggaccg acaatgccga tgcagaccat gcacgctttg tcgacgccgg tctgtcggcg       360
     ggagacacac tgagcttttc gcgcgctttc accgacacgt cgggcaaaag cgataccgca       420
     tcgttcaggc tcgcctttgc tgcgacccgc ggagcacccg acgcgttcct gttcgcctgc       480
     cagcggatca atgcgccaat ggtggaccgt acggctttgc aggcgcacgc caatggcgct       540
     actggcattt tggaagtggt ggcgatcagc gaccagcccg ccgaacaata tcggatgatt       600
     tccgtggcgg cgaatgaccc tgctgctaac ggcgagggcc ggacgtttct cctgccgaat       660
     gccaccttga gcgtgctcga cgccaaatct ttcaccgctc gcttcggcat tccggcgggt       720
     tcatccacga agctccgctt cgccgcgatc gtctttgcgg tccgcagcat cgatgtcgcg       780
     tcgagcctgc ttgcagccaa tgctatacag cacgatatag cgggcactga tattgtcgtg       840
     cggccggcat ccggacaggg cgcggctttc atcttccggg agatcccatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page