(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0396

BA000012.MLR0396     Location/Qualifiers
FT   CDS_pept        280968..282041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0396"
FT                   /product="nitrogen reguration protein; NifR3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47985"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47985"
FT                   /db_xref="GOA:Q98MX8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX8"
FT                   /protein_id="BAB47985.1"
FT                   /translation="MARECATNGHAWFLCMVNSARLAAPLNVGGVEIRNRVFLAPMSGI
FT                   TDEPFRRRAHAHGAGLVVSEMVASGELAKGRAGFDLRIRHSGLPVHMVQLAGREAIHMA
FT                   EGARIAAGEGADIIDINMGCPAKKVTGGYAGSALMLDLDHALSLIEAVVGAVKVPVTVK
FT                   MRLGWDEGALNAPILARRAEQAGVKMVTVHGRTRCQFYQGKADWRAIARVKEAVSIPVV
FT                   ANGDVCSPAEAAAILDQSGADAVMVGRAHYGAPWIAGGIAAAAAGEVAANVPENRAALA
FT                   DYIVGHYEDMLALYGVESGLRQARKHLGWYLDRHAVGVADDDRKAILTAFDPARVIALL
FT                   RNVFSRDPQPLSLRSAA"
     atggctagag aatgtgcaac gaatggacat gcttggtttt tgtgcatggt taactcagcc        60
     agattggccg cgcctttgaa cgtcggcggc gtggaaatcc gcaaccgcgt cttcctcgcg       120
     ccgatgtcgg gcatcaccga cgagccgttc cggcggcgcg cccatgcgca cggcgcgggc       180
     ctggtcgtgt ccgaaatggt ggcaagcggc gaactcgcca agggtagggc cggcttcgac       240
     ctgcgcatac ggcattccgg cctgcccgtc catatggtgc agctggcggg ccgcgaagcg       300
     atccacatgg ccgaaggcgc acggatcgcc gcaggcgagg gcgccgacat catcgacatc       360
     aacatgggct gcccggccaa gaaggtcacc ggtggttatg ccggttcggc attgatgctg       420
     gatctcgacc atgcgctgtc gctgatcgag gccgtggtcg gcgcggtcaa ggtgccggtg       480
     acggtcaaga tgcggctcgg ctgggacgaa ggcgccctca atgcgcccat cctcgcgcgc       540
     cgtgccgagc aggcgggcgt caagatggtg acggtgcatg gccgcacgcg ctgccagttc       600
     taccagggca aggccgactg gcgcgccatc gcccgcgtca aggaagccgt gtccattcca       660
     gtcgttgcca atggcgatgt ctgttccccg gccgaggcag ctgccattct cgaccaatcg       720
     ggcgccgatg cggtgatggt cggtcgcgcg cattacggcg cgccctggat cgccggtggc       780
     atcgcggcag cggcggcagg cgaagtggcg gccaacgtgc ccgagaatcg cgcggctctg       840
     gcagactata tcgtcggcca ctacgaggac atgctggcgc tttatggcgt tgagagcggt       900
     ttgcgccagg cgcgcaaaca tctgggctgg tatcttgatc gccatgctgt tggcgtcgcc       960
     gacgatgacc gaaaggccat cctgacggcg ttcgatccgg cccgcgtcat tgccttgctg      1020
     cgcaatgtgt tttcgcgtga tccgcaaccc ttgagcctgc ggagcgccgc atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page