(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0398

BA000012.MLR0398     Location/Qualifiers
FT   CDS_pept        283177..284637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0398"
FT                   /product="nitrogen assimilation regulatory protein; NtrC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47987"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47987"
FT                   /db_xref="GOA:Q98MX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX6"
FT                   /protein_id="BAB47987.1"
FT                   /translation="MTARGNILVADDDAAIRTVLNQALSRVGHEVRVTSNASTLWRWVA
FT                   AGEGDLVITDVVMPDENAFDMLPRIKKARPELPVIVMSAQNTFMTAIRASETGAYEYLP
FT                   KPFDLTELLNIVNRALSEPRRPKIDARPDEQPETMPLVGRSAAMQDIYRMLARMMQTDL
FT                   TVMISGESGTGKELVARALHEYGRRRGGPFVAINMAAIPRDLIESELFGHEKGAFTGAQ
FT                   NRSTGRFEQAEGGTLFLDEIGDMPMEAQTRLLRVLQQGEYTTVGGRTPIKTDVRIVAAT
FT                   NKDLRTLINQGLFREDLFYRLNVVPLRLPALRERSEDVPDLVRHFFKLGEMEGLQTKRI
FT                   SSGGIELMKRYPWPGNVRELENLVRRLAALYSQDEISAEIIEAELKTGERPVVPGGGNL
FT                   IPDDLSIGQAVEHFLQRYFASFAGELPPAGLYQRILSEVEYPLVLASMTATRGNQIKAA
FT                   ELLGLNRNTLRKKIRELGVNVYKSSRPG"
     atgaccgctc gcggcaatat tctcgtcgcc gatgacgatg cggcgatccg caccgtgctc        60
     aaccaggctc tctcgcgcgt cgggcacgag gtgcgcgtca cctccaacgc ctcgaccttg       120
     tggcgctggg tggccgcggg cgagggcgac cttgtcatca ccgacgtcgt catgccggat       180
     gaaaacgcct tcgacatgct accgcgcatc aagaaggcgc ggccggaact gccggtcatt       240
     gtcatgagcg cccagaacac gttcatgacg gcgatccgcg catccgagac aggcgcctat       300
     gaatatctcc cgaaaccgtt cgacctgacc gaactgctca acatcgtcaa ccgggcgctg       360
     tctgagcccc gccggccgaa gatcgatgcg cggcccgatg agcagccgga aacgatgccg       420
     ctggtcggcc gctcggcggc catgcaggac atctatcgca tgctggcgcg catgatgcag       480
     accgacctca cggtgatgat ctcgggcgaa tccggcaccg gcaaggaact ggtggcgcgt       540
     gcgctgcacg aatatggccg tcgtcgcggc gggccgtttg tcgccatcaa tatggcggcg       600
     atcccgcgtg acctgatcga atcggaactg ttcggccatg agaagggtgc cttcaccggc       660
     gcgcagaacc gctccaccgg ccgtttcgag caggccgagg gcggcacgct gttcctcgac       720
     gagatcggcg acatgccgat ggaggcacag acgcgcctgc tgcgcgtcct gcagcagggc       780
     gagtacacga ccgtcggcgg acgcacgccg atcaagaccg atgtgcgcat cgtcgccgcc       840
     accaacaagg atctgcgcac gctgatcaac cagggactgt tccgcgagga tctgttctat       900
     cgtctcaatg tcgttccgct gaggctgccg gcattgcgcg agcgctccga ggacgtgccc       960
     gatctcgtgc gccacttctt caagctcggc gagatggaag ggctgcagac caagcgcatc      1020
     tcgtccggcg gcatcgaact gatgaagcgc tacccgtggc cgggcaatgt gcgcgaactg      1080
     gaaaacctgg ttcgccggct ggccgctctt tattcgcagg acgagatttc cgccgagatc      1140
     atcgaggcgg agctgaagac cggcgagcgc cccgtggtgc ccggcggcgg caacctcatt      1200
     cccgacgatc tctccatcgg ccaggcagtg gagcacttcc tgcagcgcta tttcgcctcg      1260
     tttgccggcg aattgccgcc cgccggactc taccagcgca tactgtccga ggtcgaatat      1320
     ccgctggtcc tggcctcaat gacggcaacc cgcggcaacc agatcaaggc tgcggaactg      1380
     ctggggctga accgcaacac gctgcgcaag aagattcgcg aactgggcgt caacgtctat      1440
     aaatcgtcgc ggccgggctg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page