(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0399

BA000012.MLR0399     Location/Qualifiers
FT   CDS_pept        284838..287054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0399"
FT                   /product="nitrogen regulation protein; NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47988"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47988"
FT                   /db_xref="GOA:Q98MX5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX5"
FT                   /protein_id="BAB47988.1"
FT                   /translation="MLALPGVVAVVGALVMAAISFTILVGATPIAPDARTTWALIALNA
FT                   AFVLFLMALVGREVHRIVMARRHGKAASRLHVRIVAMFALVAAIPAIMVAIIASITLDI
FT                   GLDRWFEIRTKTIVNSSLSIADAYVQENARNLQGTTLSMAYDLDASRSLYGLDRTGFLD
FT                   LLNKEAVGRSLAHAALIKPDGSFVMSAQTDADFAMPEPPEGSVSSATDGKPVLIEPRTR
FT                   NIMGAIVKLREIEGLYLYTIRLVDPEVIKARQIVRSNTDEYRNLEDNRRTSQVAFALPY
FT                   LSLTLIIILSAIWTGIAVADRLVRPIRQLIGAADEVATGNLDVAVPVRSSDGDVASLGD
FT                   TFNKMLLELKSQRNEILSAKDLIDERRRFSEAVLAGVTAGVIGVDPYGIVTIVNRSAES
FT                   MLAISASAALGQNLSAILPHVGRVFEIGRQSGKPVYREQVTFFRAGTERTFNVQITIEA
FT                   GDDGSEEKSYVVTVDDITDLVQAQRSSAWADVARRIAHEIKNPLTPIQLSAERIKRRYG
FT                   KVITEDREVFDQCTDTIIRQVEDIGRMVDEFSAFARMPKPEMKAIDLRESLREASFLVE
FT                   VSRADITFERIFGNEPLKGTFDSRLLAQAFGNVIKNAAEAIDGLEQKDGSHGIIRIQAG
FT                   RQNGAIRIDVIDNGKGLPRENRQRLLEPYMTTREKGTGLGLAIVKKIVEDHGGRLELHD
FT                   APADFHGGRGAMISIILPLAAVTPLRGEGKTEHERETEKVGNGV"
     ttgctggcgc tgcccggcgt ggtggccgtc gtcggcgcgc tggtcatggc ggccatctcg        60
     ttcaccatcc tggtcggcgc gacgccgatc gcgcctgacg ccaggacgac ctgggcgctg       120
     atcgcgctca atgccgcttt cgtgctgttc ctcatggcgc tggtcgggcg cgaagtgcat       180
     cgcatcgtca tggcccgccg gcatggcaag gcggcctcgc ggctgcatgt gcgcatcgtc       240
     gccatgttcg cgctggttgc cgccatcccc gccatcatgg tggccatcat cgcctcgatc       300
     acgctcgata tcggcctcga ccgctggttc gagattcgta ccaagacgat cgtcaattcc       360
     tcgctgtcga tcgccgatgc ctatgtccag gagaacgccc gcaatctgca gggcacgacg       420
     ctgtcgatgg cctatgatct cgacgcgtcg cgctcgctat acggccttga tcgcacaggc       480
     tttctcgacc tcctgaacaa ggaggcggtg ggccggtcgc tggcccatgc ggcgctgatc       540
     aagcccgacg gttcgttcgt catgagcgcg cagaccgatg ccgatttcgc catgccggaa       600
     ccgccggaag gttcagtcag cagcgccacc gacggcaagc cggtgctgat agagccgcgc       660
     acccgcaaca tcatgggcgc catcgtcaag ctgcgcgaaa tcgagggcct ctacctctac       720
     accatccgcc ttgtcgatcc cgaggtgatc aaggcgcggc agatcgtcag gtccaacacc       780
     gacgagtatc gcaatctcga agacaacagg cgcacgtcgc aagtagcctt cgcgctgccc       840
     tatctgtcgc tgaccctgat catcatcttg tcggcaatct ggacgggcat cgcggtcgcc       900
     gaccgcctcg tgcggccgat tcgccagctc attggcgctg ccgacgaagt ggcgaccggc       960
     aatctcgacg tcgcggttcc ggttagatct tccgacggcg atgtcgcctc gcttggcgac      1020
     accttcaaca agatgctgct ggagctcaaa tcgcagcgca acgagatcct gtcggcgaag      1080
     gacctgatcg acgagcggcg gcgcttctcc gaagccgtgc ttgccggtgt caccgccggc      1140
     gtcatcggcg tcgatcccta cggcatcgtc accatcgtca accgttcggc cgaatcgatg      1200
     ctggccatct ccgccagtgc cgcactcggg cagaaccttt ccgctatttt gccgcatgtc      1260
     ggccgcgtct tcgagatcgg ccgccagtcg ggcaagcccg tctaccgcga gcaggtgacg      1320
     tttttccgcg ccggcaccga gcgcactttc aacgtgcaga tcaccatcga agcgggcgac      1380
     gacggctcgg aagagaaatc ctacgtcgtg accgtcgacg acatcaccga tctggtccag      1440
     gcgcagcgtt cttcagcctg ggccgacgtc gcgcgccgca tcgcccacga gatcaagaac      1500
     ccgctgacgc cgatccagct ttcggccgag cgcatcaagc gccgatacgg caaggtcatc      1560
     accgaggacc gcgaggtttt cgaccaatgc accgacacca tcatccggca ggtcgaggac      1620
     atcggccgca tggtcgacga attctccgcc ttcgcgcgca tgcccaagcc cgagatgaag      1680
     gccatcgatc tgcgcgaatc gctgcgcgag gcatccttcc tggtcgaggt cagccgcgcc      1740
     gacatcacct tcgagcggat tttcggcaat gaaccgctca agggcacatt cgacagccgc      1800
     cttctggcgc aggctttcgg caatgtgatc aagaacgccg ccgaggcgat cgacggactg      1860
     gaacaaaagg acggttcgca cggcataatc cggattcaag ccggccgtca gaatggcgcg      1920
     attcgtatcg acgtcatcga caatggcaaa ggcctgccgc gcgagaatcg ccaacggctg      1980
     ctcgagccct atatgaccac gcgcgagaaa ggcaccgggc ttggtctcgc tatcgtcaag      2040
     aagatcgtgg aggaccatgg cggcaggctg gaacttcatg atgcgcctgc ggacttccac      2100
     ggcggccgcg gggcgatgat cagcatcatc ctgccgctgg cggccgtcac gccgttgcgc      2160
     ggcgaaggca agacggaaca cgaaagagaa actgaaaagg tcggtaatgg cgtctga         2217
//

If you have problems or comments...

PBIL Back to PBIL home page