(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0409

BA000012.MLR0409     Location/Qualifiers
FT   CDS_pept        295495..296211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0409"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47998"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47998"
FT                   /db_xref="GOA:Q98MW5"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW5"
FT                   /protein_id="BAB47998.1"
FT                   /translation="MNTPNLGYRVGTGAQAGAVFDEGLRQHMLRVYNYMGLGLVVTGLV
FT                   AFLVSSTPALYVPIFSSPLKYVVMLAPLAFVLLFSFRMQTMSAASAQAMFWAFCAVMGL
FT                   SLASVFLVFTGTSIARTFFIAATMFGATSLYGYTTRRDLTQFSSFLIMGLIGVVIASIV
FT                   NIFLGSTALQFAISVIGIAVFIGLTAWDTQTIKEQYAENFDAESRQKLAVFGAFSLYLN
FT                   FINIFQLLLNFTGERE"
     atgaacacgc ccaatctggg atatcgtgtc ggcaccggcg cccaggccgg agccgtcttt        60
     gacgagggtc tgcgccagca tatgctgcgc gtctacaact atatgggcct tggcctcgtg       120
     gtcaccggcc tggtcgcctt cctggtttcg tcgacgccgg cgctctacgt cccgatcttc       180
     tccagcccgc tgaaatatgt ggtgatgctg gcgccgctcg ctttcgtgtt gctgttttcg       240
     ttcaggatgc agaccatgtc ggcggcaagc gcccaggcga tgttctgggc cttctgcgcg       300
     gtgatgggcc tgtcgctcgc ctccgtgttc ctggtcttca ccggcaccag catcgcgcgc       360
     accttcttca tcgccgccac catgttcggc gccaccagcc tctacggcta tacgacgagg       420
     cgcgacctga cccagttctc gtccttcttg atcatgggcc tgatcggcgt ggtgatcgcc       480
     agcatcgtca acatcttcct cggttcgacc gcgctgcaat tcgccatttc ggtgatcggc       540
     atcgccgtct tcatcggcct gaccgcctgg gacacgcaga cgatcaagga acaatatgcc       600
     gagaatttcg acgcggaatc gcgccagaag ctggctgtct ttggtgcgtt ctcgctctac       660
     ctgaacttca tcaacatctt ccagctgctg ctgaatttca cgggcgagcg cgagtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page