(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0415

BA000012.MLR0415     Location/Qualifiers
FT   CDS_pept        299710..300051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0415"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48002"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48002"
FT                   /db_xref="GOA:Q98MW1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW1"
FT                   /protein_id="BAB48002.1"
FT                   /translation="MANAPEAIVVYLLGDGAPFRQYVAVDGDDIVGRVRSVGAVGATWC
FT                   ADMYVEPSRRRRGIGQALMAKMLRDDQARGSRCSGATATHAGALLYPCMGYERTGTLLI
FT                   LGPTSRTAS"
     atggccaacg cgccagaggc gatcgttgtc tatctgctcg gcgatggcgc gccgttccgc        60
     cagtatgtgg cggtggatgg cgacgatatc gttgggcgcg tgcgcagcgt gggcgctgtc       120
     ggcgccacct ggtgcgcgga catgtatgtc gagccttcgc gccggcgccg cggcatcggc       180
     caggcgctga tggctaaaat gctgcgcgac gaccaggctc gtggatcacg atgctccggt       240
     gcgacggcga cgcacgccgg agctctactt tatccctgca tgggctatga acggactgga       300
     acgctgctga tactcggccc gacgagcaga acagcctcat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page