(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0421

BA000012.MLR0421     Location/Qualifiers
FT   CDS_pept        303476..304639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0421"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48006"
FT                   /db_xref="GOA:Q98MV7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV7"
FT                   /protein_id="BAB48006.1"
FT                   /translation="MGRCKGRSRSVVSRRCKRQTGMATTTQYDPRQSLDARLRQAGASK
FT                   TVYALVTPEIETVKAELLGNSGGNGPDPIRVAYLDQFRHAWTGKQNALHRRFFDTWLGW
FT                   AKPMAPLDAADYPFSYPTSGASEPLFHLIADYGNRARLERFPPRLVIFRGEYEGYKAYA
FT                   EACGIAVAEYERHAWRDVADTVDPKDLLCLSQPSAIDGMVWPQANAFLRRLSLRANPAQ
FT                   LVLDLTYVGATAEPPAETILAGAPCVSAVVISLSKPFGAYYDRIGGVFCRSENLGLFGN
FT                   QWFKNLTSLQLGIRLMERFDVFAMARRYTGIQGSVAEHAGRALGLALTPADVFILAQAT
FT                   ASAENDPDLAAYLTRAPGAADSRPRLCLTPGMAERIGMAGANSGTLS"
     gtgggccgtt gcaaaggcag gtcgcgatcc gtagtttcgc gacggtgcaa aaggcagacc        60
     ggcatggcca cgaccacgca atatgatccg cggcagtcgc tcgatgcgcg cttgcgtcag       120
     gccggcgcca gcaaaaccgt ttacgccctc gtcacacccg agatcgaaac agtgaaggcc       180
     gagctgctcg gcaacagcgg gggaaacggt cccgatccga tccgcgtcgc ctatctcgat       240
     cagtttcgcc atgcctggac cggaaagcag aacgcgctgc acaggcggtt cttcgacaca       300
     tggctcggct gggccaagcc gatggcgccg ctggacgccg ctgactatcc attcagctat       360
     ccgacatcag gcgccagtga gccgcttttt catctgattg ccgattacgg caaccgcgca       420
     cgcctcgaga ggtttccccc gcggcttgtg atctttcgcg gcgaatatga aggctacaag       480
     gcctatgcgg aagcctgcgg cattgcggtg gcggagtacg aacgccacgc ctggcgcgat       540
     gtcgccgaca ccgtcgatcc caaggatttg ctctgtctta gccagccttc ggccatcgac       600
     ggcatggtgt ggccgcaggc caatgccttt ctgcgtcggc tgagcctgcg cgccaacccg       660
     gcccagctcg tcctcgattt gacctatgtc ggggcgactg ccgagccgcc ggcggagacg       720
     atcctcgccg gcgcgccttg cgtgagcgcc gtggtgatca gcctgtccaa gccgttcggc       780
     gcctattacg accgcatagg cggtgtgttc tgccgatcgg agaatctcgg actgttcggc       840
     aatcagtggt tcaagaacct gacatcgctg caattgggaa taaggctgat ggagcgcttc       900
     gacgtcttcg ccatggcgcg ccgatacacc ggcattcaag gcagcgtcgc tgagcatgcg       960
     ggccgggcgc tcggccttgc cttgacgccg gcggacgtct tcattctcgc ccaggccacg      1020
     gccagcgctg agaacgatcc cgatctggct gcgtatctga cgcgcgcccc tggtgccgca      1080
     gattcccggc cacgcttgtg cctgacgcca ggcatggcgg aacggatcgg catggccggc      1140
     gcgaattccg ggacgttgtc atga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page