(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0422

BA000012.MLR0422     Location/Qualifiers
FT   CDS_pept        304573..305487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0422"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48007"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48007"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV6"
FT                   /protein_id="BAB48007.1"
FT                   /translation="MPDARHGGTDRHGRREFRDVVMKNLLPLVTSDDIHAHCLAHWKTE
FT                   AFRSSHRQGGYIHGIVDQYARLPRFSCETTNDRLERAHFCTWWGLTMRRDDYAAPAIED
FT                   LYLLHEIWHAAHMPFIPGIGFEAFHGKMERNELEASVASELLVYFKIDGLRESAFPHPI
FT                   YADRFLNDPAMRLLWRENEVVATNTLLEARRNVMYSKPEGDMDLSERWIRKFTMQNRQW
FT                   SIVWADRYLEIEDHMHRFQQIALGGDRKAASDFHADWIEAEAAMDMVDHVPFRDQALLF
FT                   ATIYWANRAKYDSALAVQRATQS"
     gtgcctgacg ccaggcatgg cggaacggat cggcatggcc ggcgcgaatt ccgggacgtt        60
     gtcatgaaga atttgctccc gctcgtgacg agcgatgaca ttcatgccca ctgcctggcg       120
     cactggaaga cggaagcatt ccgatcctcg catcgccagg gcggttatat tcacggcatc       180
     gtcgatcagt atgcccgcct gccccgtttc agctgcgaga ccaccaatga ccgcctggag       240
     cgtgcccact tctgcacctg gtgggggctg accatgcgcc gggatgacta tgccgccccg       300
     gccatcgaag acctctacct cctgcacgaa atctggcacg ccgcgcatat gcctttcatc       360
     ccgggcatcg gattcgaggc tttccacggc aagatggagc gcaacgaact cgaagccagc       420
     gtggcgtccg agctgctggt ctatttcaag atcgatgggc tgagggaaag cgcctttccc       480
     catcccatct acgcggaccg gtttctcaat gatccggcga tgcggctgct gtggcgcgag       540
     aacgaagtcg tcgccaccaa cacattgctc gaggcgcgcc gcaacgtcat gtattccaag       600
     cccgaaggcg acatggacct gagcgagcga tggattcgca aattcaccat gcagaaccgg       660
     caatggtcga tcgtctgggc cgaccgctac ctcgagatcg aggatcatat gcaccggttc       720
     cagcagatag cgctcggcgg cgacaggaaa gcagcctctg actttcacgc cgactggatc       780
     gaagccgaag ccgccatgga catggtggac cacgttcctt tccgcgacca ggcactgcta       840
     ttcgccacca tctactgggc caatcgcgcg aagtatgatt ccgcgcttgc ggtgcagcgg       900
     gcaacccagt cctag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page