(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0474

BA000012.MLR0474     Location/Qualifiers
FT   CDS_pept        345774..346442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0474"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48053"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48053"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR0"
FT                   /protein_id="BAB48053.1"
FT                   /translation="MVSPRYCTQSTGFSCHVGGHGVALWHYMGVLGMAKDVTRGGKSET
FT                   LTIRLDPKTRFILEYLSRLKGQNITTVVERAIVAAASQEMVPDPQWPDQPDGWQRFWDV
FT                   SDGCRALRMAERAEFFPTYEEERRLAFAKSHWPFFYSSEDRARFVNHYIDVLWPRIDEF
FT                   IQIYDDQKQSDYFAAGKAMQAALRAAQLAAPEWPIPAKTKPPEKPKPAPNRELDDEIPF
FT                   "
     gtggtttccc caaggtattg cacgcaatcc acgggttttt cttgccatgt aggcggccac        60
     ggtgtagcgc tgtggcatta tatgggagtg ctaggtatgg caaaagacgt cacgcggggc       120
     gggaaaagcg agacactcac catccggttg gacccaaaga cgcggttcat tctggagtac       180
     ctttccagac tgaagggaca gaacattact acagtggttg agcgcgcgat tgttgccgcc       240
     gcttcacagg aaatggttcc tgatccgcag tggcccgacc agccagacgg gtggcagcgc       300
     ttttgggatg ttagtgatgg atgtcgtgcg ctgcgaatgg cagagcgcgc agagttcttc       360
     ccaacctatg aggaggaacg acgcttggct tttgcgaaaa gtcattggcc gtttttttac       420
     agctccgaag acagggcgcg tttcgtcaat cactatatcg acgttctatg gcctcggatc       480
     gatgagttca tccagattta tgatgaccaa aaacagagcg attattttgc cgccggcaag       540
     gccatgcagg cggcgcttag ggcggcgcaa cttgctgctc cagaatggcc gatcccagca       600
     aaaaccaaac cgccagaaaa accaaaacct gcgccaaacc gcgaactcga tgacgaaatc       660
     ccgttctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page