(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0478

BA000012.MLR0478     Location/Qualifiers
FT   CDS_pept        349847..350212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0478"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48057"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ6"
FT                   /protein_id="BAB48057.1"
FT                   /translation="MALALGGALMKWRLYFVVMTLAVTSGCAADYLNNYDTVTLASGDA
FT                   NHTNSLLQTVDPFNPNSNNTHIEGDGQRIVGVVQRYRSPISAGGGYSGNCPTDNSVAAD
FT                   GSHCGKRSAESRPGGAM"
     gtggctttgg cgctgggggg tgccttgatg aagtggcgtt tgtattttgt cgtgatgact        60
     ctggctgtca cgtccggctg tgctgccgac tatttgaaca actatgacac ggtgacgctt       120
     gcatctggtg atgcaaatca cacgaattcg cttctgcaaa ccgtcgatcc tttcaacccc       180
     aacagcaaca acacgcatat cgaaggtgac ggccaacgca tcgttggcgt ggttcaacgg       240
     tacagatcgc cgatctctgc cggtggcggc tattccggca actgcccgac cgataacagc       300
     gtggcggctg atggctcaca ttgcggcaag cgatccgctg aaagccgtcc aggcggtgca       360
     atgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page