(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0479

BA000012.MLR0479     Location/Qualifiers
FT   CDS_pept        350305..351066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0479"
FT                   /product="succinoglycan biosynthesis protein; ExoI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48058"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48058"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ5"
FT                   /protein_id="BAB48058.1"
FT                   /translation="MPLRLVLVTVAAASALATQFVMHNGGSLPEINLQNLIKPKPVAIS
FT                   GVASVIDGDTIEMHGQRVRFNGIDAPESAQYCDDAKGFEYPCGRRSAEALDGFLAASKP
FT                   VQCAFVTWDRYGRFVGDCTRADGSSVAAWMVEHGQALDWPKYSNGAYAAQQAKAKAAKV
FT                   GLWIGSFQAPWDWRAQHSDDAQTPTAPLFATGNGNPGCNIKGNISASGERIYHLPGQKY
FT                   YAVTVISQNKGERWFCSEAEAVAAGWRRSKR"
     gtgccgcttc gcctcgtgct ggtgacggta gccgcggctt ctgccttggc aacgcaattc        60
     gtcatgcaca acggcggatc gctgccggaa atcaatctgc aaaacctgat caagccaaag       120
     ccagtagcca tttccggcgt ggcgtcagtc atcgacggcg acacaattga gatgcacggg       180
     cagcgggtcc gcttcaacgg aatcgatgca ccggagagcg cccaatattg cgacgacgca       240
     aagggcttcg aatatccctg cggccgacgt tctgccgaag ctctggacgg cttcctagca       300
     gcctccaagc ccgtccagtg cgcattcgtc acatgggatc gctacgggcg cttcgtcggc       360
     gactgcacgc gagctgacgg ctccagcgtg gccgcatgga tggttgaaca cggtcaggcg       420
     cttgattggc ctaaatacag caacggcgca tatgcagcgc aacaggcgaa agccaaggcg       480
     gcaaaggttg gtttgtggat aggatcgttt caggcgccat gggactggcg agcgcaacat       540
     agtgacgatg cacaaacgcc aactgcaccg ctttttgcga ccggcaacgg caaccccggt       600
     tgcaacatca aaggcaacat ctcggcgagc ggtgaacgca tctaccattt gccgggacag       660
     aaatactacg ccgtgaccgt cattagccaa aacaagggcg aaaggtggtt ctgctcggaa       720
     gcggaagccg ttgcggccgg ctggcggcga tcgaaacgtt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page