(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0480

BA000012.MLR0480     Location/Qualifiers
FT   CDS_pept        351083..351436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0480"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48059"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48059"
FT                   /db_xref="InterPro:IPR022444"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ4"
FT                   /protein_id="BAB48059.1"
FT                   /translation="MKPHVRAAVAAIALSHSSGRNVSSVYSYSELKYVNIDASVQGNVV
FT                   DAYDYNNSCHIDGTLPSLYHYGQNSHIDLQPQSGGQYDGYDYGSNSHFELTVSGNSAEL
FT                   YDYGEGGFFSFST"
     atgaaacctc acgttagagc agccgttgcg gcgattgcat taagccattc gtccggtcgc        60
     aacgtgtcat ctgtttactc atattcggaa ttgaaatacg tcaacatcga tgcgtcggtg       120
     caagggaacg tcgttgacgc ttacgactac aataacagtt gccatatcga cggaacgctt       180
     ccgagcctct accactacgg tcagaacagt catattgacc ttcagccgca atcaggcggc       240
     caatatgacg gctacgacta tgggagcaac tcccatttcg aactaacggt gagcggcaac       300
     agtgccgagc tttacgacta cggcgagggc ggattcttct ctttctcgac ttga             354
//

If you have problems or comments...

PBIL Back to PBIL home page