(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0514

BA000012.MLR0514     Location/Qualifiers
FT   CDS_pept        379691..381511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0514"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48087"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48087"
FT                   /db_xref="GOA:Q98MM6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM6"
FT                   /protein_id="BAB48087.1"
FT                   /translation="MGRVLVWLITAISLFTLSPRPAMSEPKHAIAMQGEPALPPDYTHF
FT                   DYVNPDAPKGGSITYCVVGSFDNLNPFILKSLRTTARGMMDLTYGNLVFEPLMQRNYDE
FT                   AFSLYGLLADSADMDSERKSIEFHLNPNAKWSDGEPVTPEDVLFTYDVFTDKGRPPYNA
FT                   RMSLIAKLEKTGDHSVRFTFNDKANRETPMIIALTPILPKHAFDKETFDKTTLKPLIGS
FT                   GPYTIAQVAPGQRIVFKRNPDYWGKDVPAKRGFDNYGQITIEYFLNANAKLEAFKKGLC
FT                   AIDDDGDPVKRERDLDFPAFHRGEVVSETFDTGIPPVVTGFLFNTRLPKFSNPVVRRAL
FT                   GMLYDFEWANKNLFGGKYTRTMSYWQNSELSALGHPADDREKALLAPYPGRVPPDVMDG
FT                   TWKPPVTDGSGQDRKVLKAAFDLLKSIGYHVQDGTMLDPDGKPFGFEILTASQDEERLA
FT                   GIYQRTLEKIGINVSIRSLDGDQIQSRKQRFDFEALIGSSGFNNSLSPGFEQLGRWSSE
FT                   AAKAEGSFNLAGVADPAVDAAIEAMLRARSKEDYVAAVRVLDRLLISGNYMVPMQYNTQ
FT                   QWLAYWNYLEHPKKTPIFGYQLPTWWRKPN"
     atgggccgcg ttcttgtttg gctgatcacc gcgatatcgc tttttaccct ttcgccgcgg        60
     ccggccatgt cggaaccgaa gcatgccatc gccatgcagg gcgagccggc actgccgccc       120
     gactataccc atttcgacta cgtcaatccc gatgcgccaa aggggggcag catcacctat       180
     tgtgttgtcg gcagcttcga caacctcaac cctttcatcc tgaaaagcct acgcacgacg       240
     gcgcgcggca tgatggatct gacctatggc aatctcgttt tcgagccgct gatgcagcgc       300
     aattacgacg aggccttcag tctctatggc ctgctcgccg acagcgcgga catggattcc       360
     gagcgcaagt cgatcgaatt ccatctcaat cccaatgcaa agtggtcgga tggcgagccg       420
     gtgacgccgg aggatgtgct gttcacctat gatgtcttca ccgacaaggg ccgcccgccc       480
     tacaacgcac gcatgagcct gatcgccaag cttgaaaaga cgggtgatca cagcgtgcgc       540
     ttcaccttca atgacaaggc caatcgcgaa acacccatga tcatcgcgct gacgccgatc       600
     ctgccgaaac atgccttcga caaggagact ttcgacaaga caacgctgaa accgctgatt       660
     ggcagtggac cttataccat tgcccaggtg gcgccgggcc agcgcatcgt gttcaagcgc       720
     aaccccgatt attggggcaa ggatgtcccg gccaagcgcg gcttcgacaa ttacggccag       780
     atcaccatcg aatatttcct caacgccaac gccaagctcg aggccttcaa gaaaggcctc       840
     tgcgccatcg atgatgacgg cgatccggtc aaacgggagc gtgatctgga cttcccggcc       900
     ttccacaggg gtgaggtggt ttctgaaacc ttcgacaccg gcattccgcc ggtggtgacc       960
     ggtttcctgt tcaacacgag gctgccgaag ttctccaatc cggtggttcg acgcgcgctc      1020
     ggcatgcttt acgatttcga atgggcgaac aagaatctgt tcggcggcaa atacacccgc      1080
     acgatgagtt actggcagaa ctccgagctt tcagcgctcg gccatccggc cgacgacagg      1140
     gaaaaggccc tgctcgcccc ctaccccggc cgtgtgccgc ccgatgtcat ggacggcacc      1200
     tggaaaccgc ccgtgaccga cggttcgggg caggaccgca aagtgctgaa ggcggctttc      1260
     gatctcctga aaagcatcgg ttaccacgtg caggacggta cgatgctcga tcccgacggc      1320
     aaacctttcg gattcgagat cctgactgct tcgcaagacg aggaacggct ggccggcatc      1380
     tatcagcgca cactggagaa gatcggcatc aatgtcagca tccgtagcct cgacggcgat      1440
     cagatccagt cacgcaagca gcgcttcgat ttcgaggctc tgatcggatc cagcggcttc      1500
     aacaattcgc tgtcgccagg cttcgaacag cttggacgct ggagctccga ggcggccaag      1560
     gccgaaggct cgttcaatct cgccggcgtt gccgatccgg cggtcgatgc ggcgatcgaa      1620
     gcgatgctgc gcgcccgctc gaaggaggat tacgtcgccg ccgtccgcgt tctcgaccgg      1680
     ctgttgatct cgggcaacta catggtgccc atgcagtaca acacgcagca gtggcttgct      1740
     tactggaatt atctggaaca tccgaagaag acgcccatat tcggttatca gctgccgaca      1800
     tggtggcgca aaccgaactg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page