(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0515

BA000012.MLR0515     Location/Qualifiers
FT   CDS_pept        381528..382208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0515"
FT                   /note="similar to FrnE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48088"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48088"
FT                   /db_xref="GOA:Q98MM5"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM5"
FT                   /protein_id="BAB48088.1"
FT                   /translation="MSEANAVTVDVVSDVVCPWCFIGQKRLDKAVAAAGDVDVHIRWRP
FT                   FQLDPTIPPQGKDRREYMLAKFGSDERIREIHARIEPLGEAEGISFAFDAIKVAPNTLD
FT                   AHRLIRWAGAAGEAVQNRLVRRLFQLNFEEGVNIGDHAVLVEAAREAGMDASVVATLLP
FT                   TDADVEAVRTEIATASRMGISGVPCFLLEGKYAVMGAQDVDTLADAIRQVAAAKARGEL
FT                   DKVG"
     atgagcgaag cgaacgccgt aaccgtcgat gtggtgtcgg atgtcgtctg cccctggtgc        60
     ttcatcggcc agaagcggct ggacaaggcg gttgccgcgg ccggcgatgt cgatgtgcat       120
     atacgctggc gaccgttcca gctcgatccg accattccgc cgcaaggcaa ggaccgccgg       180
     gagtatatgc ttgccaagtt cggcagcgac gagcgcattc gcgagattca tgcccgcatc       240
     gagccgcttg gcgaggcaga gggcatttcc tttgccttcg atgccatcaa ggtggcgccg       300
     aacacgctcg atgcgcaccg cctgatccgc tgggcgggtg ctgccggtga agccgtgcag       360
     aacaggctgg tccgccgcct cttccagttg aatttcgagg aaggcgtcaa catcggcgac       420
     catgccgtgt tggtcgaagc cgcccgcgag gccggcatgg atgcctccgt ggtcgccacg       480
     ctcttgccga ccgacgccga tgtcgaagcg gtgcgcacgg agatcgccac ggcgtcgcgc       540
     atgggcatat cgggcgtgcc gtgcttcctg ctcgaaggca aatatgccgt gatgggtgct       600
     caggacgtcg acacgctggc ggatgccatc cgccaggtgg cggcggcgaa ggcacggggc       660
     gaattggaca aggtcggctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page