(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0519

BA000012.MLR0519     Location/Qualifiers
FT   CDS_pept        383247..385232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0519"
FT                   /product="ATP-binding protein of ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48090"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48090"
FT                   /db_xref="GOA:Q98MM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM3"
FT                   /protein_id="BAB48090.1"
FT                   /translation="MIRIGRRSQESVPDRLHRGPAGRSHLTPVSSMRSFWGLMKAYWFS
FT                   ERWKEAWTLTVVIALLTALSSKAGVWFALALGELGNSIAFFHDAANTSPLQAILTNAGI
FT                   LVLLVVLKDAGFTGVRGLVSATLHRKWRGWLNSQFNKALLDGNHTHFHAQHGSAAGGIV
FT                   APDNIDQRIQESIKDMTGGAIGLAMGVLGVATSLYFIGENLIGSSVEVKGLEFLGGYGS
FT                   AVLAFLAVAIYVPLNTWIAVKLGRLLERLNIRMQQAEGSYRSELTTFLRRSFHVAASHG
FT                   EDVQKSMHDKLYVDIDKTWGKLNVVNNGYTSFELIYNFLGARIVAYGPGLVSFIHNRLD
FT                   YKGYITGSEMVAQLISQCSWFIHVMPAIATLRANSQRVTELANAIENVQHPQAFYSQTG
FT                   QSDFHYASQNPVFGLTIQKLELAHQGEDATPFLSAANLRFRRGEWTFLKGESGCGKTSL
FT                   IKAINGLWPYGRGTIVFPDGVKSFYAAQEVKLQQVSLKQLVCLPGSEHDHGDAQVASAL
FT                   HKAGLGDFIEHMANESREGKSWDQVLSGGQKQKLVVARIILQQPGLLFLDEATGALDPE
FT                   GKIAFHQAIKDNCPDVTVISVMHEAVAPRSAAGTEFYHSIVLIADGVATKKPLTPTLPV
FT                   ELTTILTQPRPVEDKWLRFSRRLKQK"
     gtgattcgga tcggcagacg atcgcaggag tcagtaccgg atagactaca ccgcggcccc        60
     gcagggcggt cgcatttgac gccggtatcc tcgatgcgca gtttctgggg gctgatgaag       120
     gcctactggt tctccgagcg ctggaaggaa gcctggacgc tcactgtcgt catcgccctg       180
     ctgacggcgc tttccagcaa ggccggcgtc tggtttgcct tggcattggg cgagttgggc       240
     aattcgatcg ccttcttcca cgatgcggcc aacaccagcc cgctgcaggc aattctgacc       300
     aatgccggca tacttgtgct gctggtcgtg ctcaaggatg ccggcttcac cggcgtgcgc       360
     ggtcttgtct cggcaaccct gcaccgaaag tggcgcggct ggctgaatag ccagttcaac       420
     aaggctctgc tcgacggcaa tcatacccac ttccatgctc agcatggttc ggcggctggc       480
     ggtatcgtcg cacccgacaa catcgaccag cgcatccagg aatcgatcaa ggacatgacg       540
     ggcggggcga tcggtctcgc catgggcgtt ctgggtgttg cgacctcgct ctattttatc       600
     ggcgaaaatc tgatcggatc ctcggtagag gtcaaaggac tggagttcct cggcggttat       660
     ggcagcgcag tgctggcctt cctcgccgtc gccatttacg tgccgttgaa cacttggatt       720
     gcggtcaagc ttggccgctt gctcgagcgg ctcaatatcc gcatgcagca ggccgagggc       780
     agctaccgca gtgaactgac gacgttcctg cgccgcagct tccatgtcgc cgcctcgcat       840
     ggcgaagatg tgcaaaagtc gatgcacgac aagctctatg tcgatatcga caagacctgg       900
     ggcaagctca atgtcgtcaa caatggctac acgtcgttcg agctgatcta caacttcctc       960
     ggcgcccgga tcgtcgccta tggtcccggt ctggtgtcgt tcatacacaa tcgcttggac      1020
     tacaagggct acataaccgg ctccgaaatg gtcgcccagt tgatcagcca gtgctcgtgg      1080
     ttcatccatg tcatgcccgc catcgccacg ctgcgcgcca acagccagcg tgtcacggaa      1140
     ctggcgaacg cgatcgagaa cgtccagcat ccgcaggcgt tctacagcca gaccggtcag      1200
     tccgacttcc actatgccag ccagaaccct gttttcggcc tgaccatcca gaagctcgaa      1260
     ctggcacatc agggcgagga cgcgacaccg ttcctcagtg ccgccaattt gcgcttccgg      1320
     cgcggcgagt ggacgttcct caaaggcgaa tccggttgcg gcaagacttc gctgatcaag      1380
     gcgatcaacg gcctctggcc ttatggccgc ggcaccattg tcttccccga cggggtgaag      1440
     agtttttacg ccgcccagga ggtcaagctc cagcaggtgt cgctgaaaca gctggtctgc      1500
     ctgccgggct ccgagcacga ccatggcgat gcccaggtcg cgtcggcgct gcacaaggcg      1560
     ggccttggcg acttcatcga gcatatggcc aatgaaagcc gtgaaggcaa aagctgggat      1620
     caggtcttgt cgggcggcca gaagcagaag ctggtggtgg cccgcatcat cctgcagcag      1680
     ccggggctgc tgttcctcga cgaggcgacc ggcgccctcg acccggaggg caagattgcc      1740
     ttccaccagg cgatcaagga caactgcccc gatgtcaccg tgatcagcgt catgcacgaa      1800
     gcagtggcgc cacgatcggc tgccggcacc gagttctacc actcgatcgt gttgatcgcc      1860
     gacggcgtcg ccaccaagaa gccgctgact ccgaccctgc cagtcgaact caccacgatt      1920
     ctgacccagc cacggccggt cgaggataaa tggctgcgtt tctcgcgccg gctgaagcag      1980
     aaataa                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page