(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0521

BA000012.MLR0521     Location/Qualifiers
FT   CDS_pept        385505..386869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0521"
FT                   /product="Mg2+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48091"
FT                   /db_xref="GOA:Q98MM2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM2"
FT                   /protein_id="BAB48091.1"
FT                   /translation="MNDFSPVADDEAVAIARILANDHVADVVEALNHESRETATDLLCA
FT                   VPFERLVEIFDQPELDGAPELADALPRAKASKLLTAMSVDRAADILRELDEPARSELLG
FT                   ALAPPLRATLLSILGYPEGSAASIMTTEFVSVPSDWTVGRTLDYIRKVERTRETVYAIY
FT                   IVDPQTHLLVRSTGLRRLITGEPDDPVLSVAPDRVPVTVTPLTDRETLAQTISKYDLLA
FT                   VPVVDHGKILGIVTIDDIIDTMIEETTEDVHRFGGMEALDEPYMKMSFLAMIQKRAGWL
FT                   CALFLSEMLTANAMQSYESELERAIVLTLFIPLIMSSGGNSGSQATSLVIRAMALREIG
FT                   LGDWWRVALRELPTGLVLGSILGVVGVCRITLWQYFGFYDYGPHWPLIAATVGAALVGI
FT                   VTFGSLSGSMLPFALKRVGFDPASASAPFVATLVDVTGLVIYFSVAQVILRGTLL"
     atgaatgatt tttcccccgt ggcggacgac gaggccgttg ccatcgcccg catccttgca        60
     aacgaccatg tcgccgacgt ggtcgaggcg ctcaaccatg aatcgcgcga aaccgcgacg       120
     gatctgcttt gcgccgtacc cttcgaacgg ctggtcgaga tcttcgacca gcccgaactc       180
     gacggtgcgc ccgaactcgc ggacgccctg ccccgcgcta aggcaagcaa gctgctcacc       240
     gccatgtcgg tcgaccgtgc ggccgacata ctgcgcgagc tcgacgagcc ggcgcgatcc       300
     gaactgctcg gcgcactggc gccgccgctg cgcgccactc tgctttccat cctgggctat       360
     cccgaaggca gcgccgcttc gatcatgacg acggagttcg tcagcgttcc ctcggactgg       420
     accgtcgggc gcacgctcga ctacatccgc aaggtcgagc ggacgcgcga aaccgtctac       480
     gcgatctaca tcgtcgatcc gcaaacgcat ctcctggtgc ggtcgaccgg cctgcgccgg       540
     ctcattactg gtgagccgga cgacccggtc ctgtcggtgg caccggaccg cgtgccggtc       600
     acggtcaccc cgctgaccga tcgtgaaacc ctggcgcaga cgatctccaa atatgatctt       660
     ctcgccgtgc cggtcgtcga ccatggcaag atcctcggca tcgtcaccat cgacgacatc       720
     atcgacacga tgatcgaaga aacgacggag gatgtgcacc gcttcggcgg catggaagcg       780
     ctcgacgagc cctacatgaa gatgagcttc ctcgccatga tccagaagcg cgccggctgg       840
     ctgtgcgcgc tgtttctcag tgaaatgctg accgccaatg ccatgcagag ctacgagagc       900
     gagttggaaa gggcgatcgt gctcaccctc ttcatcccgc tgatcatgag ctccggcggc       960
     aattccggct cgcaggcgac ctcgctggtc attcgggcga tggcgctgcg cgagattggc      1020
     ctcggcgact ggtggcgggt tgccttgcgc gaactgccga ccggcctggt gctgggatcg      1080
     atccttggcg ttgtcggcgt ctgccgcatc acgctgtggc agtatttcgg tttctacgat      1140
     tacggcccgc actggccgct gattgccgcg acggttggcg ctgcactggt cggcatcgtc      1200
     accttcggct ccctctcggg gtcgatgctg cccttcgcgc tgaaacgggt cggtttcgac      1260
     cccgccagcg catcggcgcc gtttgtcgcc acgctggtcg atgtcaccgg gctggtgatc      1320
     tatttctcgg tggcgcaggt catcctgcgc ggcacgctgc tgtag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page