(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0532

BA000012.MLR0532     Location/Qualifiers
FT   CDS_pept        392340..392822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0532"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48098"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48098"
FT                   /db_xref="GOA:Q98ML5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML5"
FT                   /protein_id="BAB48098.1"
FT                   /translation="MGMATAKYVMKRILMMLAGYLVAVLVGLVAVAAIYAALSSLPNAP
FT                   AYFDVMGVSPIAVLVVPPLGMFVYFLTIVVTGLQTLIFALIAEFFSLRNALMHMVFGAA
FT                   AAAGGFFLIWPVPAEDMDPERWADIGIIAAAGLVAGLIYWLIAGREAGFRRPLSQI"
     atgggcatgg cgacggcgaa gtatgtgatg aaacgcatcc tgatgatgct ggccggctat        60
     ctggtcgccg tgctggttgg cctggtcgcc gtggcggcga tctacgccgc gctcagttcg       120
     ctgcccaacg cgccggccta tttcgatgtc atgggcgtca gcccgatcgc cgttttggtg       180
     gtgccaccgc tcggcatgtt cgtctatttc ctgacgattg tcgtgaccgg gctgcagacg       240
     ctgatcttcg cgctgattgc cgagttcttc tcgttgcgca atgccctgat gcacatggtc       300
     ttcggcgccg ctgccgccgc cggtggcttc ttcctgatct ggccggttcc ggcggaggat       360
     atggatccgg agcgctgggc cgacatcggc atcatcgcag ccgccggcct cgtcgccgga       420
     ttgatctact ggctgatcgc cgggcgggag gcgggtttcc gccgcccgtt gtcgcaaatc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page