(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0542

BA000012.MLR0542     Location/Qualifiers
FT   CDS_pept        400609..401103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0542"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48108"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK5"
FT                   /protein_id="BAB48108.1"
FT                   /translation="MLRLYRIGLSALTTVLSLATPVTTTANAKPFTYVNARFGTVCTFP
FT                   DEIFTDRQPEPENGDGQVWLSADGASLTCSGILNVDDDTPKSFVADEKASKEPGYTVTY
FT                   SKTGKNWAVLSGMKDGNIFYERRLFGRDGVIRTVWIDYPPALKAKYDPLVGAIAASLKG
FT                   Q"
     gtgctgcgtc tttatcgtat cggcttgtcg gcgctgacca cagttctgtc cttggcgacg        60
     ccagtcacaa caactgcaaa cgccaagccc ttcacctatg tgaacgcgcg cttcggcacc       120
     gtctgcactt ttcccgacga gatattcacc gatcgtcagc ctgagccgga aaatggcgac       180
     ggacaggtct ggctgagcgc ggacggcgcc agcctgacct gctccggcat cctcaacgtc       240
     gatgacgaca cgccgaaaag ctttgtcgcc gatgaaaagg caagcaagga acctggctac       300
     accgttacct acagcaagac cggcaagaac tgggcggtgt tgtcgggcat gaaggatggc       360
     aatatctttt acgagcggcg cctgttcggc agggatggcg tcatccgcac cgtctggatc       420
     gattatccgc cggccttgaa ggcgaaatac gatccgctcg tcggcgccat tgccgcaagc       480
     ctcaaggggc agtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page