(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0547

BA000012.MLR0547     Location/Qualifiers
FT   CDS_pept        402728..403354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0547"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48111"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48111"
FT                   /db_xref="GOA:Q98MK2"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MK2"
FT                   /protein_id="BAB48111.1"
FT                   /translation="MRRDIAGIVLAGGQSRRMGGGDKSLLPLGSGSVLDQILSRFGPQI
FT                   EILALSANGDPERFSRFGLPVLADTVEGFAGPLAGILTGLEWAIAGTPCKAVVTAAGDT
FT                   PFLPLDLVDRLAAAARDHPGSIAVASSAGRRHPTFALWPTECRDALRHFLVDEDNRRVS
FT                   DFIERHGHVEVEFRFVQSAGLDPFFNINVPDDLAQAARLLQSMTS"
     atgaggcgag atattgcagg gatcgtcctg gccggtggcc agtcaaggcg gatgggaggc        60
     ggcgacaaga gcctgttgcc gctcggcagc ggcagcgtgc ttgaccaaat cctgtcgcgc       120
     tttggcccgc agatcgaaat cctggcgctg agcgccaatg gcgatcccga acgcttttcc       180
     cgtttcggac tgcccgtgct tgccgacacc gtcgaaggct ttgccgggcc gcttgccgga       240
     atcctaacgg gcctcgaatg ggccattgcc ggcacgcctt gcaaggccgt cgtaaccgcc       300
     gcaggcgaca cgccgttcct gccgcttgat ctcgtcgatc gcctggcggc ggcagcccgc       360
     gaccatcccg gttccattgc cgtcgcctcc tcggccggta ggcggcaccc gacctttgcg       420
     ctgtggccga ccgaatgccg cgatgctttg cggcatttcc tggtcgatga ggacaacagg       480
     cgcgtttcgg acttcatcga gcgccatggt cacgtggagg tggaattccg gttcgtgcaa       540
     tccgctgggc tcgatccttt cttcaacatc aatgtgcctg atgaccttgc ccaggccgcg       600
     cgcctgttgc agagcatgac atcatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page