(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0549

BA000012.MLR0549     Location/Qualifiers
FT   CDS_pept        404013..404798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0549"
FT                   /product="probable amino acid binding protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48113"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48113"
FT                   /db_xref="GOA:Q98MK0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK0"
FT                   /protein_id="BAB48113.1"
FT                   /translation="MRIALRIALAASAALLTLGVAQAQEKTLRIGTEGAYPPFNNLTSD
FT                   GKLVGFDIDIAQALCDQMKVKCTFVAQDWDGIIPALQAGKFDAIVASMSITPERKEKVD
FT                   FTHKYYNTPSALAVPKDSTLKGVTKADLAGKTIGVATTTTHFNYASKTYTDSTVKGYPS
FT                   SPEEQADLANGRLDAIEDDIVVLQQWLDSPDGACCKILGQPSPQPVEIFGPGAGIAVRK
FT                   GETDLVNKLNEAIDAIRANGKYKEINDKYFKFDVFGAES"
     atgcgtattg cactgcgtat cgcgctcgcc gcatcggctg cgctgctgac gctcggcgtc        60
     gcccaggccc aggaaaagac cctgcggatc ggcaccgaag gcgcctatcc cccgttcaac       120
     aacctcacct ccgacggcaa gctcgtcggc ttcgatatcg acatcgccca ggcgctttgc       180
     gatcagatga aggtgaagtg caccttcgtc gcccaggatt gggacggcat catcccggca       240
     cttcaggccg gcaagttcga cgccatcgtc gcttcgatgt cgatcacgcc tgagcgcaag       300
     gagaaggtcg acttcaccca caaatactac aacacaccct cggctctcgc agtgccgaaa       360
     gacagcacgc tgaagggcgt gaccaaggca gatctcgccg gcaagaccat cggcgtcgcc       420
     acgacgacca cccatttcaa ctatgcctcg aagacctaca ccgacagcac cgtgaagggc       480
     tatccgagca gccccgagga gcaggcagat ctggccaatg gtcgtctgga cgccatcgag       540
     gacgatatcg tcgtgctcca gcagtggctg gactcgcctg atggcgcctg ctgcaagatt       600
     ctcggccagc cctcgccgca accggtcgag atcttcgggc cgggcgccgg catagccgtg       660
     cgcaagggcg agaccgatct ggtcaacaag ctcaatgagg ccatcgacgc catccgcgcc       720
     aatggaaaat acaaggaaat caacgacaag tacttcaagt tcgacgtctt cggcgccgag       780
     tcctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page