(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0556

BA000012.MLR0556     Location/Qualifiers
FT   CDS_pept        408685..409152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0556"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48119"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48119"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ4"
FT                   /protein_id="BAB48119.1"
FT                   /translation="MNHFTSITGLAAALSLCAAGASAETMHIFWKDLRPATQLAGYALP
FT                   VDRDGDLVYQFLLVPWTGACSHMPTPPPNQIVLVTPAHPYKMSQAYQSVAVTGALKPDI
FT                   EKSQLFILDGVSVIQSGYSVRKADVIGVDTVPDTVTLPVNSPWSFLNKKKN"
     atgaaccatt tcacgtcaat cacagggctc gcggccgcgc tgtctctctg cgctgccggc        60
     gcctcggccg agaccatgca catcttctgg aaggatttgc gcccggcgac ccagttagcc       120
     ggctatgcat tgccggtcga tcgcgacggc gatctcgtct atcagttcct gctggtgcca       180
     tggacgggcg catgcagcca catgccgacg ccgccgccca atcagatcgt gctggtcacg       240
     ccagcccatc cctacaagat gtcgcaagcc taccagtcgg tcgccgtcac cggcgccctg       300
     aagccggaca tcgaaaagag ccagctgttc attctggatg gcgtcagcgt catccagtcc       360
     ggttatagcg tgcgcaaagc ggatgtgatc ggcgtcgaca ccgtgccgga cactgtcacc       420
     ctgccggtga actcgccctg gagtttcctc aacaagaaga agaactga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page