(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0562

BA000012.MLR0562     Location/Qualifiers
FT   CDS_pept        411726..413246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0562"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48124"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48124"
FT                   /db_xref="GOA:Q98MI9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI9"
FT                   /protein_id="BAB48124.1"
FT                   /translation="MPLQRSNTADKFIVDRRKPHRNSDVARAVRKTRDRLSQQAGNPDF
FT                   DRELLKLHAGAMTSGAVVIPLLVLAIAAAGWLAGVGNEIGLWALFTLTCYTIVAFMARR
FT                   IERTEASELNPLQTRREFLVGHFLCGLGWGWFVVLGCGACAVDQFPVVKAVVLLLAMAG
FT                   TALMASSLSGALLATFAVPVALYAYVGTRLWMPVEAMMAGLLVLSLPFFVYVARQLNRA
FT                   SLMLLSFRSEKDALIAELETAKSMSDEARRRAEDANLAKSRFLASMSHELRTPLNAILG
FT                   FSEVMANEVLGPMSNPTYRDYAHDVHDSGQHLLDLINEILDLSRIEAGRYQLNEEPVML
FT                   LNIVEDCCHMMELKARNKDIRVVQDFEQTLPRLFADERAVRQITLNLLSNAIKFTATGG
FT                   EIRVRVGWTAGGGQYISVKDNGPGIPEDEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQ
FT                   GLLAMHGGEFELHSKLREGTEAIAIFPLSRVMEELPALPTAAVAARRR"
     atgcccttgc aacgctcgaa cacagcggac aagttcattg tggaccgcag gaaaccccat        60
     cgcaacagcg atgtggcgcg cgcggtgcgc aagacgcgcg accgtctttc gcagcaggcc       120
     ggcaatcccg atttcgaccg cgaattgttg aaactccatg ccggcgccat gacaagcggc       180
     gccgtggtga tcccgttgct cgtcctggcg atcgccgctg ccggctggct cgccggcgtc       240
     ggcaacgaga tcgggctctg ggcgttgttc acgctcactt gctatacgat cgtcgccttc       300
     atggcgcgac gcatcgagcg cacggaagcg tccgagctta accccttgca aacgcgacgg       360
     gaattcctgg taggccattt cctttgcggc ctcggctggg gctggttcgt cgtgctcggc       420
     tgcggcgcct gcgcggtcga ccagtttccg gtggtcaagg cggtggtgct gcttcttgcc       480
     atggccggga cggcgctcat ggcctcatcg ctgagcggcg cgctgctggc gactttcgcc       540
     gtaccggtgg cgctctatgc ctatgtcggt accaggctgt ggatgccggt ggaggcgatg       600
     atggccgggc tgcttgtcct gtcgctgcct ttcttcgtct atgtcgcccg tcagctcaac       660
     cgcgcctcgc tgatgctgtt gtcgttccgc tccgaaaagg atgcgctgat cgccgagctg       720
     gagacagcga aatccatgtc ggacgaggcg cggcggcggg ccgaggacgc caatctggca       780
     aagtcgcgtt tcctcgcttc gatgagccac gaattgcgca cgccactcaa cgccattctc       840
     ggcttttccg aggttatggc gaacgaggtg ctggggccta tgagcaatcc cacctatcgc       900
     gattatgccc atgacgtgca tgattccggc cagcacctgc tcgacctgat caacgaaatc       960
     ctcgatctgt cgcgcataga agccggtcgc taccagctca acgaagagcc ggtgatgttg      1020
     ctcaacatcg tcgaggattg ctgccatatg atggagttga aggcgcgcaa caaggatatc      1080
     cgcgtcgtcc aggatttcga acagacattg ccgcggctgt tcgcagacga gcgcgccgtg      1140
     cgccagatca cgctcaacct tctgtccaat gccataaagt tcaccgccac cggcggcgaa      1200
     atccgcgtcc gcgtcggctg gacggcgggc ggcgggcaat acatctccgt caaggacaat      1260
     ggtccgggga ttcccgagga cgagatcccg gtcgtgctct cggccttcgg ccagggctcg      1320
     atcgccatca agagcgccga acaaggcacc gggctcggcc tgccgatcgt gcaaggcctg      1380
     cttgcaatgc atggcggcga gttcgaactt cattccaaac tgcgtgaagg cacggaggcg      1440
     attgccatct tccccctgag ccgggtgatg gaagaactgc cggcgttgcc gaccgcggcg      1500
     gtggcggcgc gacggcggta a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page