(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0564

BA000012.MLR0564     Location/Qualifiers
FT   CDS_pept        414475..414705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0564"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48126"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48126"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI7"
FT                   /protein_id="BAB48126.1"
FT                   /translation="MTAIESPCILVCSIDMKTGFCFGCGRTREEIGAWMGMTPETRRNV
FT                   MAELPARLETVERRPRRETRRTRMARERDAL"
     atgacggcca tcgaatcccc ctgcatcctg gtctgttcga tcgatatgaa aaccggcttc        60
     tgcttcggtt gcggccgcac ccgcgaggaa atcggcgcct ggatgggaat gacgcccgaa       120
     acgcgccgca atgtgatggc cgaactgccg gcccgactgg aaacggtcga gcgccggccg       180
     cgccgcgaaa cgcgccgcac ccgcatggcg cgcgaacgcg acgcactcta g                231
//

If you have problems or comments...

PBIL Back to PBIL home page