(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0571

BA000012.MLR0571     Location/Qualifiers
FT   CDS_pept        418464..419033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0571"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48132"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48132"
FT                   /db_xref="GOA:Q98MI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI1"
FT                   /protein_id="BAB48132.1"
FT                   /translation="MVGRLCMEPFAGEGAGQPGRRLRFAARPGLGPFRDRSLAFRRASP
FT                   DALPCKSPPGDCPFDNFERIVDNRHSRLDLDDNPASRTGLADHNSRSAVRALVLSVAKS
FT                   SPAVPHHHPGSIHRGRALTRHIGFENDLLDEPLVRFEFNALVELVDNPKHVSIRHTRLI
FT                   IFLVIAAIVGWNFLRKGGDQHDFWFW"
     atggttgggc gcctctgcat ggagccgttc gctggcgaag gcgcagggca acccggacgg        60
     aggctcaggt ttgccgcacg accgggcttg gggccctttc gcgaccgttc tttggccttt       120
     cgtcgagcct caccagacgc gcttccttgt aagtcgccgc ctggagattg ccctttcgat       180
     aatttcgaac ggatcgtaga caatcgccat agccggttgg atttggacga caaccctgcc       240
     agccgaaccg ggcttgccga ccacaactcg cgatcggccg tgcgcgcact cgttctatca       300
     gtcgccaagt cttcccccgc ggtgccccat catcatccgg gaagcataca tcgtgggcga       360
     gcgcttaccc ggcatattgg cttcgagaac gatctgctcg acgaacccct ggttcgtttc       420
     gaattcaatg cactcgtcga gcttgtcgac aatccaaagc atgtatctat ccgccacact       480
     cggctgatca tttttcttgt catagccgca atcgtcggct ggaatttctt gaggaaaggc       540
     ggagatcaac atgatttttg gttttggtag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page